Gene_locus Report for: penmq-b6qcc8Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333). Putative uncharacterized protein Comment only n-term Pfam A DUF2235 12 423 Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Trichocomaceae: N E > Talaromyces: N E > Talaromyces marneffei: N E
6_AlphaBeta_hydrolase : penmq-b6q6i6Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Alpha/beta hydrolase, putative, penmq-b6q354Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Ribonuclease p/mrp subunit, putative, penmq-b6q438Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized protein, penmq-b6qft6Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized protein, penmq-b6qiy4Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized protein, penmq-b6qq22Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized protein, penmq-b6qw21Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized protein. A85-EsteraseD-FGH : penmq-b6qnb3Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Esterase, putative. abh_upf0017 : penmq-b6qvd9Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Hydrolase, alpha/beta fold family protein. Acetylxylan_esterase : penmq-b6q797Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Acetylxylan esterase 2, putative, penmq-b6qnp7Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Acetyl xylan esterase (Axe1), putative. Acidic_Lipase : penmq-b6qea2Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Triglyceride lipase-cholesterol esterase, putative, penmq-b6qj89Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Ab-hydrolase associated lipase, putative. AHL-acylase : penmq-b6qcs8Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Valacyclovir hydrolase, putative. Carboxypeptidase_S10 : penmq-cbpyaPenicillium marneffei,Talaromyces stipitatus, Carboxypeptidase Y homolog A. CGI-58_ABHD5_ABHD4 : penmq-b6qks8Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Alpha/beta hydrolase, putative. Cutinase : penmq-b6qg04Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Cutinase, putative. DPP4N_Peptidase_S9 : penmq-dapbPenicillium marneffei, Talaromyces stipitatus, Probable dipeptidyl-aminopeptidase B. Duf_726 : penmq-b6qh02Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) DUF726 domain protein, penmq-b6qku6Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) DUF726 domain protein. Duf_1749 : penmq-b6q3x2Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized protein, penmq-b6qsw7Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Siderophore biosynthesis lipase/esterase, putative. Epoxide_hydrolase : penmq-b6q6p2Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Epoxide hydrolase, putative, penmq-b6qdz2Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Epoxide hydrolase, putative, penmq-b6qj15Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Epoxide hydrolase, putative, penmq-b6qry3Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Epoxide hydrolase, putative. Fungal-Bact_LIP : penmq-b6q527Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Secretory lipase, putative, penmq-b6qhn8Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Lipase 8, putative. Haloacetate_dehalogenase : penmq-b6q3a3Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Epoxide hydrolase, putative. Haloperoxidase : penmq-b6q522Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Arylesterase, putative. Kynurenine-formamidase : penmq-b6qrx8Penicillium marneffei, Talaromyces marneffei. N-formylkynurenine formamidase. LIDHydrolase : penmq-b6qkg9Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized protein. PolyAspartate-hydrolase : penmq-b6qm40Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized protein. PPase_methylesterase_euk : penmq-b6qmy9Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Protein phosphatase methylesterase 1. Proline_iminopeptidase : penmq-b6q3q6Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333). Proline iminopeptidase, penmq-b6q8w3Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333). Proline iminopeptidase. Prolylcarboxypeptidase : penmq-b6qd16Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Extracelular serine carboxypeptidase, putative, penmq-b6qts8Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Serine peptidase, family S28, putative, penmq-b6quf0Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Serine peptidase, putative. Steryl_acetyl_hydrolase : penmq-b6qb64Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized protein Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Penicillium marneffei ATCC 18224: N, E.
Talaromyces marneffei ATCC 18224: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: penmq-b6qcc8
Colored MSA for Duf_2235 (raw)
MEPTIGPQQAPKTFVLCFDGTGNKFSGDESDSNVLKIFRMLDRSRGTQFH
YYQPGIGTYVTSTSLSSTGTVHRIRSAYLKAKDSAIGSSFDQHVMGGYKF
LMRYYVPGDDIYFFGFSRGSYIARFLAEMLDYIGLLEAGNEELIRFAWKT
FAKWQQRRGQTDQDQAEKKKLFNYMKAFRETFSRPISRIRFMGLFDTVNS
VPRFESAWMQRSKFPYTARSSALVIRHAVGIDERRAKFRQDLISETRPWH
ASHTHHDNYLRDHMHHLHLNREKPDEVPKITLNNDGTDVDLEKAAQEEEK
PAARRGREESESVYRTPRGSSAGSAQNIDRYRAPSPFSNRKLSHPNLDVP
EINLSVDDSASTHSDVTSLQVPLKLGEDDEKEQDIREVWFPGGHADIGGG
WSLDKDESWALSHAPLVWMVQ
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MEPTIGPQQAPKTFVLCFDGTGNKFSGDESDSNVLKIFRMLDRSRGTQFH
YYQPGIGTYVTSTSLSSTGTVHRIRSAYLKAKDSAIGSSFDQHVMGGYKF
LMRYYVPGDDIYFFGFSRGSYIARFLAEMLDYIGLLEAGNEELIRFAWKT
FAKWQQRRGQTDQDQAEKKKLFNYMKAFRETFSRPISRIRFMGLFDTVNS
VPRFESAWMQRSKFPYTARSSALVIRHAVGIDERRAKFRQDLISETRPWH
ASHTHHDNYLRDHMHHLHLNREKPDEVPKITLNNDGTDVDLEKAAQEEEK
PAARRGREESESVYRTPRGSSAGSAQNIDRYRAPSPFSNRKLSHPNLDVP
EINLSVDDSASTHSDVTSLQVPLKLGEDDEKEQDIREVWFPGGHADIGGG
WSLDKDESWALSHAPLVWMVQ
|
|
|
|
