Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: penpu-axylest

Penicillium purporogenum acetyl xylan esterase II precursor (EC 3.1.1.72) (axe-2)

Relationship
Family|Acetylxylan_esterase
Block| X
Position in NCBI Life Tree|Penicillium purporogenum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Trichocomaceae: N E > Talaromyces: N E > Talaromyces purpureogenus: N E


Molecular evidence
Database
No mutation
3 structures: 1BS9, 1G66, 2AXE
No kinetic





No Substrate
No inhibitor
1 Genbank : AF015285
1 UniProt : O59893
3 Structure : 1BS9, 2AXE, 1G66
1 UniProt : O59893
1 Interpro : O59893
1 Pfam : O59893
1 PIRSF : O59893
1 SUPERFAM : O59893
Sequence
Graphical view for this peptide sequence: penpu-axylest
Colored MSA for Acetylxylan_esterase (raw)
MHSKFFAASLLGLGAAAIPLEGVMEKRSCPAIHVFGARETTASPGYGSSS
TVVNGVLSAYPGSTAEAINYPACGGQSSCGGASYSSSVAQGIAAVASAVN
SFNSQCPSTKIVLVGYSQGGEIMDVALCGGGDPNQGYTNTAVQLSSSAVN
MVKAAIFMGDPMFRAGLSYEVGTCAAGGFDQRPAGFSCPSAAKIKSYCDA
SDPYCCNGSNAATHQGYGSEYGSQALAFVKSKLG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHSKFFAASLLGLGAAAIPLEGVMEKRSCPAIHVFGARETTASPGYGSSS
TVVNGVLSAYPGSTAEAINYPACGGQSSCGGASYSSSVAQGIAAVASAVN
SFNSQCPSTKIVLVGYSQGGEIMDVALCGGGDPNQGYTNTAVQLSSSAVN
MVKAAIFMGDPMFRAGLSYEVGTCAAGGFDQRPAGFSCPSAAKIKSYCDA
SDPYCCNGSNAATHQGYGSEYGSQALAFVKSKLG


References
3 more
    Title: The acetyl xylan esterase II gene from Penicillium purpurogenum is differentially expressed in several carbon sources, and tightly regulated by pH
    Chavez R, Schachter K, Navarro C, Peirano A, Bull P, Eyzaguirre J
    Ref: Biol Res, 37:107, 2004 : PubMed

            

    Title: Acetyl xylan esterase II from Penicillium purpurogenum is similar to an esterase from Trichoderma reesei but lacks a cellulose binding domain
    Gutierrez R, Cederlund E, Hjelmqvist L, Peirano A, Herrera F, Ghosh D, Duax W, Jornvall H, Eyzaguirre J
    Ref: FEBS Letters, 423:35, 1998 : PubMed

            

    Title: Purification and characterization of two acetyl xylan esterases from Penicillium purpurogenum
    Egana L, Gutierrez R, Caputo V, Peirano A, Steiner J, Eyzaguirre J
    Ref: Biotechnol Appl Biochem, 24:33, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer