Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pethy-dad2

Petunia hybrida (Petunia) DAD2 ABHF7401 homologue to High tillering - Dwarf Dwarf88/HTD2

Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Petunia hybrida
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Petunioideae: N E > Petunia: N E > Petunia x hybrida: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
7 structures (e.g. : 4DNP, 4DNQ, 6AP6... more)
No kinetic





No Substrate
2 inhibitors: MNAB, QADD2
1 UniProt : J9U5U9
>3 Structure links 4 more: 6UH8, 6UH9, 6O5J
1 UniProt : J9U5U9
1 Interpro : J9U5U9
1 Prodom : J9U5U9
1 Pfam : J9U5U9
1 PIRSF : J9U5U9
1 SUPERFAM : J9U5U9
Sequence
Graphical view for this peptide sequence: pethy-dad2
Colored MSA for RsbQ-like (raw)
MGQTLLDALNVRVVGSGERVLVLAHGFGTDQSAWNRILPFFLRDYRVVLY
DLVCAGSVNPDFFDFRRYTTLDPYVDDLLHILDALGIDCCAYVGHSVSAM
IGILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEAN
YEAWVNGFAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRG
VLGLVKVPCHIFQTARDHSVPASVATYLKNHLGGKNTVHWLNIEGHLPHL
SAPTLLAQELRRALSHR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGQTLLDALNVRVVGSGERVLVLAHGFGTDQSAWNRILPFFLRDYRVVLY
DLVCAGSVNPDFFDFRRYTTLDPYVDDLLHILDALGIDCCAYVGHSVSAM
IGILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEAN
YEAWVNGFAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRG
VLGLVKVPCHIFQTARDHSVPASVATYLKNHLGGKNTVHWLNIEGHLPHL
SAPTLLAQELRRALSHR


References
1 more
    Title: Flexibility of the petunia strigolactone receptor DAD2 promotes its interaction with signaling partners
    Lee HW, Sharma P, Janssen BJ, Drummond RSM, Luo Z, Hamiaux C, Collier T, Allison JR, Newcomb RD, Snowden KC
    Ref: Journal of Biological Chemistry, 295:4181, 2020 : PubMed

            

    Title: Inhibition of strigolactone receptors by N-phenylanthranilic acid derivatives: Structural and functional insights
    Hamiaux C, Drummond RSM, Luo Z, Lee HW, Sharma P, Janssen BJ, Perry NB, Denny WA, Snowden KC
    Ref: Journal of Biological Chemistry, 293:6530, 2018 : PubMed

            

    Title: DAD2 Is an alpha/beta Hydrolase Likely to Be Involved in the Perception of the Plant Branching Hormone, Strigolactone
    Hamiaux C, Drummond RS, Janssen BJ, Ledger SE, Cooney JM, Newcomb RD, Snowden KC
    Ref: Current Biology, 22:2032, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer