Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phera-PrKAI2d2

Phelipanche ramosa (Hemp broomrape) (Orobanche ramosa) parasitic plant PrKAI2d2

Comment
Other strains: Phelipanche ramosa (Hemp broomrape) (Orobanche ramosa) parasitic plant; Phelipanche aegyptiaca


Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Phelipanche ramosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Lamiales: N E > Orobanchaceae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AWN64528
1 UniProt : A0A2U8XQH0
1 UniProt : A0A2U8XQH0
1 Interpro : A0A2U8XQH0
1 Prodom : A0A2U8XQH0
1 Pfam : A0A2U8XQH0
1 PIRSF : A0A2U8XQH0
1 SUPERFAM : A0A2U8XQH0
Sequence
Graphical view for this peptide sequence: phera-PrKAI2d2
Colored MSA for RsbQ-like (raw)
MSSVGPAHNVRVLGSGETTVILNQCCGADQSVWKYLTPHLIDQYRVILFD
NMGVGTTNPECFDFKRYASIEGYALDLIAILEEFSIGKCIYFGHSMTSMV
GVYASILRSDLFHKLIMLSASPRVTNTEGYEGGYKQEEVDQLYRAMELNN
ESFQLGFAPLLIGVDQGSPVAQEYSRTMFNMRPDISMSVLRTISTLDMRH
LLPHVTVPCHIIQSSQDAMIPEGMAEYIHQNLGGKSIVELMPIEGHLPQL
SMPEVTNPVLLRHIHHDIVDA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSVGPAHNVRVLGSGETTVILNQCCGADQSVWKYLTPHLIDQYRVILFD
NMGVGTTNPECFDFKRYASIEGYALDLIAILEEFSIGKCIYFGHSMTSMV
GVYASILRSDLFHKLIMLSASPRVTNTEGYEGGYKQEEVDQLYRAMELNN
ESFQLGFAPLLIGVDQGSPVAQEYSRTMFNMRPDISMSVLRTISTLDMRH
LLPHVTVPCHIIQSSQDAMIPEGMAEYIHQNLGGKSIVELMPIEGHLPQL
SMPEVTNPVLLRHIHHDIVDA


References
    Title: A Phelipanche ramosa KAI2 protein perceives strigolactones and isothiocyanates enzymatically
    de Saint Germain A, Jacobs A, Brun G, Pouvreau JB, Braem L, Cornu D, Clave G, Baudu E, Steinmetz V and Boyer FD <6 more author(s)>
    Ref: Plant Commun, 2:100166, 2021 : PubMed

            

    Title: PLANT EVOLUTION. Convergent evolution of strigolactone perception enabled host detection in parasitic plants
    Conn CE, Bythell-Douglas R, Neumann D, Yoshida S, Whittington B, Westwood JH, Shirasu K, Bond CS, Dyer KA, Nelson DC
    Ref: Science, 349:540, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer