Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pholl-AntI

Photorhabdus luminescens (subsp. laumondii)(strain DSM 15139 / CIP 105565 / TT01) plu4186 AntI polyketide shortening enzyme

Comment
AntI from P. luminescens catalyses terminal polyketide shortening in the biosynthesis of anthraquinones


Relationship
Family|Duf_1100-S
Block| X
Position in NCBI Life Tree|Photorhabdus luminescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Morganellaceae: N E > Photorhabdus: N E > Photorhabdus luminescens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6HXA: AntI from P. luminescens catalyses terminal polyketide shortening in the biosynthesis of anthraquinones
No kinetic





No Substrate
No inhibitor
2 Genbank : WP_011148290, CAE16558
1 UniProt : Q7MZT8
1 Structure : 6HXA
1 UniProt : Q7MZT8
1 Interpro : Q7MZT8
1 Prodom : Q7MZT8
1 Pfam : Q7MZT8
1 PIRSF : Q7MZT8
1 SUPERFAM : Q7MZT8
Sequence
Graphical view for this peptide sequence: pholl-AntI
Colored MSA for Duf_1100-S (raw)
MNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPA
GNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYH
WAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFF
LIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFD
GPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYF
ALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQ
SIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCY
ESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPA
GNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYH
WAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFF
LIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFD
GPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYF
ALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQ
SIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCY
ESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG


Reference
    Title: Molecular mechanism of polyketide shortening inanthraquinone biosynthesis of Photorhabdus luminescens
    Zhou, QQ, Brauer A, Adihou H, Schmalhofer M, Saura P, Grammbitter GLC, Kaila VRI, Groll M, Bode HB
    Ref: Chem Sci, 10:6341, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer