Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phopy-a0a1y1kw87

Photinus pyralis (Common eastern firefly) (Lampyris pyralis). Uncharacterized protein

Relationship
Family|Pancreatic_lipase
Block| L
Position in NCBI Life Tree|Photinus pyralis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Coleoptera: N E > Polyphaga: N E > Elateriformia: N E > Elateroidea: N E > Lampyridae: N E > Lampyrinae: N E > Photinus: N E > Photinus pyralis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GEZM01073773
1 UniProt : A0A1Y1KW87
1 UniProt : A0A1Y1KW87
1 Interpro : A0A1Y1KW87
1 Prodom : A0A1Y1KW87
1 Pfam : A0A1Y1KW87
1 PIRSF : A0A1Y1KW87
1 SUPERFAM : A0A1Y1KW87
Sequence
Graphical view for this peptide sequence: phopy-a0a1y1kw87
Colored MSA for Pancreatic_lipase (raw)
MLLVQLYVIIYAIKAISGASIDPFGWARADRLEFHIPWLPFENETRCYDE
LGCLNITRSWYHLIYRPFNVFPLPRSVINTKFILYTRANPNTSETLRALD
ENLKKSSLDLKKKIKFIIHGFIDTPLSNWVGDMKDELLKGEDLNVIIVDW
AGGSLPLYTQATANTRLVGLELGYFINFLMKNYAVDPADIHIIGHSLGAH
TAGYAGSMVPGLGRITGLDPAEPYFQGMPSHVRLDPTDAQLVDVIHTDGK
GIIFLGYGMSQSCGHVDFYPNSGKEQPGCDITQTPLIPLTLIKEGLEEAS
RVLVACNHIRAIKLFTESINSQCPYIAHQCPSYQHFVSGKCFTCKSGAGN
CAVMGYHLDASPHLENEVTPQTNKFHETIGTKFYTITGKEQPYCHRLYRI
SIELAKPLIAESWVQGFLKASLHSPSGVVHINLTPSGDMKLAHGTTHTMV
VSHPSDLGGNVKKVELNWEYDMNVLEPRTLCLLWCNDHLYVKSVTVDEME
LPGRGKRDTHFTNRLCSPSKRDYADISNGGRAVFVDVCNTDKRDVTR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLVQLYVIIYAIKAISGASIDPFGWARADRLEFHIPWLPFENETRCYDE
LGCLNITRSWYHLIYRPFNVFPLPRSVINTKFILYTRANPNTSETLRALD
ENLKKSSLDLKKKIKFIIHGFIDTPLSNWVGDMKDELLKGEDLNVIIVDW
AGGSLPLYTQATANTRLVGLELGYFINFLMKNYAVDPADIHIIGHSLGAH
TAGYAGSMVPGLGRITGLDPAEPYFQGMPSHVRLDPTDAQLVDVIHTDGK
GIIFLGYGMSQSCGHVDFYPNSGKEQPGCDITQTPLIPLTLIKEGLEEAS
RVLVACNHIRAIKLFTESINSQCPYIAHQCPSYQHFVSGKCFTCKSGAGN
CAVMGYHLDASPHLENEVTPQTNKFHETIGTKFYTITGKEQPYCHRLYRI
SIELAKPLIAESWVQGFLKASLHSPSGVVHINLTPSGDMKLAHGTTHTMV
VSHPSDLGGNVKKVELNWEYDMNVLEPRTLCLLWCNDHLYVKSVTVDEME
LPGRGKRDTHFTNRLCSPSKRDYADISNGGRAVFVDVCNTDKRDVTR


Reference
    Title: Molecular characterization of firefly nuptial gifts: a multi-omics approach sheds light on postcopulatory sexual selection
    Al-Wathiqui N, Fallon TR, South A, Weng JK, Lewis SM
    Ref: Sci Rep, 6:38556, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer