Gene_locus Report for: phyit-d0n4x1Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Stramenopiles: N E > Oomycetes: N E > Peronosporales: N E > Phytophthora: N E > Phytophthora infestans: N E
6_AlphaBeta_hydrolase : phyit-d0ns26Phytophthora infestans (strain T30-4) (Potato late blight fungus) Putative uncharacterized protein. A85-EsteraseD-FGH : phyit-d0n6q1Phytophthora infestans (strain T30-4) (Potato late blight fungus) S-formylglutathione hydrolase, putative. A85-Feruloyl-Esterase : phyit-d0ng53Phytophthora infestans (strain T30-4) (Potato late blight fungus) Putative uncharacterized protein. ABHD6-Lip : phyit-d0mqp1Phytophthora infestans (strain T30-4) (Potato late blight fungus) Putative uncharacterized protein, phyit-d0mqp2Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative. ABHD13-BEM46 : phyit-d0n5g6Phytophthora infestans (strain T30-4) (Potato late blight fungus). protein bem46-like, putative. ABHD18 : phyit-d0n4i8Phytophthora infestans (strain T30-4) (Potato late blight fungus). Putative uncharacterized protein. abh_upf0017 : phyit-d0ni28Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative, phyit-d0nrk9Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative, phyit-d0nrl4Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative. Acidic_Lipase : phyit-d0mt75Phytophthora infestans (strain T30-4) (Potato late blight fungus) Lipase, phyit-d0muv1Phytophthora infestans (strain T30-4) (Potato late blight fungus) Lipase, putative, phyit-d0mv34Phytophthora infestans (strain T30-4) (Potato late blight fungus) Lipase, phyit-d0mv35Phytophthora infestans (strain T30-4) (Potato late blight fungus) Lipase. Carboxypeptidase_S10 : phyit-kex1Phytophthora infestans (strain T30-4) (Potato late blight fungus) Carboxypeptidase D. CGI-58_ABHD5_ABHD4 : phyit-d0mxu5Phytophthora infestans (strain T30-4) (Potato late blight fungus) Cleavage induced serine protease family S33, putative, phyit-d0nj53Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative, phyit-d0nj54Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative. Cutinase : phyin-q2m440Phytophthora infestans (Potato late blight fungus) cutinase, phyin-q58g92Phytophthora infestans (Potato late blight fungus) cutinase (EC 3.1.1.-). Dienelactone_hydrolase : phyin-ENDO2Phytophthora infestans (Potato late blight fungus) putative endo-1,3,1,4-beta-glucanase. DPP4N_Peptidase_S9 : phyit-d0nfs3Phytophthora infestans (strain T30-4) (Potato late blight fungus) Dipeptidyl peptidase, putative. Duf_900 : phyit-d0n935Phytophthora infestans (strain T30-4) (Potato late blight fungus) Putative uncharacterized protein. Duf_1057 : phyit-d0n4x0Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative, phyit-d0n4x3Phytophthora infestans (strain T30-4) (Potato late blight fungus) Putative uncharacterized protein. Epoxide_hydrolase : phyit-d0nhj2Phytophthora infestans (strain T30-4) (Potato late blight fungus) Epoxide hydrolase, putative, phyit-d0nhj4Phytophthora infestans (strain T30-4) (Potato late blight fungus) Epoxide hydrolase, putative, phyit-d0nhj8Phytophthora infestans (strain T30-4) (Potato late blight fungus) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, putative, phyit-d0ns42Phytophthora infestans (strain T30-4) (Potato late blight fungus) Epoxide hydrolase, putative, phyit-d0ns43Phytophthora infestans (strain T30-4) (Potato late blight fungus) Epoxide hydrolase, putative. Kynurenine-formamidase : phyit-d0mqf7Phytophthora infestans (strain T30-4) (Potato late blight fungus). N-formylkynurenine formamidase. Maspardin-ACP33-SPG21_like : phyit-d0mwf9Phytophthora infestans (strain T30-4) (Potato late blight fungus) Maspardin-like protein. Monoglyceridelipase_lysophospholip : phyit-d0nr53Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative, phyit-d0nrb1Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative, phyit-d0nvt3Phytophthora infestans (strain T30-4) (Potato late blight fungus) Lipase, putative, phyit-d0nwb6Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative, phyit-d0nzc0Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative, phyit-d0nzc1Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S33, putative. PPase_methylesterase_euk : phyit-d0p3z2Phytophthora infestans (strain T30-4) (Potato late blight fungus) Protein phosphatase methylesterase 1. Proline_iminopeptidase : phyit-d0n6q6Phytophthora infestans (strain T30-4) (Potato late blight fungus). Proline iminopeptidase. Prolylcarboxypeptidase : phyit-d0nax9Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S28, putative, phyit-d0njf2Phytophthora infestans (strain T30-4) (Potato late blight fungus) Lysosomal Pro-X carboxypeptidase, putative, phyit-d0nkm4Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S28, putative, phyit-d0nsr8Phytophthora infestans (strain T30-4) (Potato late blight fungus) Lysosomal Pro-X carboxypeptidase, putative, phyit-d0nu41Phytophthora infestans (strain T30-4) (Potato late blight fungus) Lysosomal Pro-X carboxypeptidase, putative. S9N_PREPL_Peptidase_S9 : phyit-d0nj14Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S09A, putative, phyit-d0nwm8Phytophthora infestans (strain T30-4) (Potato late blight fungus) Serine protease family S09A, putative. Valacyclovir-hydrolase : phyit-d0p0z1Phytophthora infestans (strain T30-4) (Potato late blight fungus) Putative uncharacterized protein
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: phyit-d0n4x1
Colored MSA for Duf_1057 (raw)
MLRVLHARLLSCVRSYSRWNVLPQVEMASREARAPPPPLPSPKYLEIRRR
CTIEYVDIPPLNEAVGSHSEDPVTLVLVHGAPGSYSDFRHLIPKLNRPYM
RILGLNLPGYAGSRVSEEHYLDSISALPTADLALEAVQKLCDSGNVFLVG
HSFGAHTVINMAALETHEKFRVRGMALLAPAGCRPHKVLRPRESAMVVSL
LRRDNAVLSTLTSHLIKAIYTRLLKFPSDHPPGHYIAGLVRAGTTDFNVI
REQVDMLRKRKMPSLVAWSQNDEFMEEEIPVELARLCHPGPRLKFARGGH
NVQKTRADQIADALSRWIEEVLDKEGRVN
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MLRVLHARLLSCVRSYSRWNVLPQVEMASREARAPPPPLPSPKYLEIRRR
CTIEYVDIPPLNEAVGSHSEDPVTLVLVHGAPGSYSDFRHLIPKLNRPYM
RILGLNLPGYAGSRVSEEHYLDSISALPTADLALEAVQKLCDSGNVFLVG
HSFGAHTVINMAALETHEKFRVRGMALLAPAGCRPHKVLRPRESAMVVSL
LRRDNAVLSTLTSHLIKAIYTRLLKFPSDHPPGHYIAGLVRAGTTDFNVI
REQVDMLRKRKMPSLVAWSQNDEFMEEEIPVELARLCHPGPRLKFARGGH
NVQKTRADQIADALSRWIEEVLDKEGRVN
|
|
|
|
