Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: picp7-f2qwe3

Pichia pastoris (Yeast) UPF0613 protein PB24D3.06c

Comment
Other strains: Pichia pastoris (strains ATCC 76273 / CBS 7435 / CECT 11047 / NRR Y-11430 / Wegner 21-1; GS115 / ATCC 20864) (Yeast)


Relationship
Family|Duf_1749
Block| X
Position in NCBI Life Tree|Pichia pastoris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Phaffomycetaceae: N E > Komagataella: N E > Komagataella pastoris: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : FR839630, FN392321
2 UniProt : F2QWE3, C4R4K5
2 UniProt : F2QWE3, C4R4K5
2 Interpro : F2QWE3, C4R4K5
2 Pfam : F2QWE3, C4R4K5
2 PIRSF : F2QWE3, C4R4K5
2 SUPERFAM : F2QWE3, C4R4K5
Sequence
Graphical view for this peptide sequence: picp7-f2qwe3
Colored MSA for Duf_1749 (raw)
MVEFTLQKSEPVTGIVHSIHTQIPPKAFEFVDSSFKDIVLFVGGLTNGIL
GVGYLPLLAKALAPLGFGLVQALLSSSDRGWGTSSLKKDAAELAQLVKYL
RTKAGKRNIILMGHSTGCQDTIHYLLHQNPTEPTLRVNGAIFQAPVSDRE
AFSNELPVEELDALNEEARAILESKGPNELLPQKFRELAFNTPITAYRWL
SLMAQRGDDDYFSSYLTDEEFSNTLGAINVPFLLLYSGSDEFVPQTVDSN
KLVDRWKAIVQRNGLSDWSQYSGIIDGATHDLGPQSDAGVDRVVNFIKNL
SWDKN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVEFTLQKSEPVTGIVHSIHTQIPPKAFEFVDSSFKDIVLFVGGLTNGIL
GVGYLPLLAKALAPLGFGLVQALLSSSDRGWGTSSLKKDAAELAQLVKYL
RTKAGKRNIILMGHSTGCQDTIHYLLHQNPTEPTLRVNGAIFQAPVSDRE
AFSNELPVEELDALNEEARAILESKGPNELLPQKFRELAFNTPITAYRWL
SLMAQRGDDDYFSSYLTDEEFSNTLGAINVPFLLLYSGSDEFVPQTVDSN
KLVDRWKAIVQRNGLSDWSQYSGIIDGATHDLGPQSDAGVDRVVNFIKNL
SWDKN


References
    Title: High-quality genome sequence of Pichia pastoris CBS7435
    Kuberl A, Schneider J, Thallinger GG, Anderl I, Wibberg D, Hajek T, Jaenicke S, Brinkrolf K, Goesmann A and Pichler H <4 more author(s)>
    Ref: J Biotechnol, 154:312, 2011 : PubMed

            

    Title: Genome sequence of the recombinant protein production host Pichia pastoris
    De Schutter K, Lin YC, Tiels P, Van Hecke A, Glinka S, Weber-Lehmann J, Rouze P, Van de Peer Y, Callewaert N
    Ref: Nat Biotechnol, 27:561, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer