Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pig-a0a1s6l948

Sus scrofa (Pig). Carboxylic ester hydrolase PLEC4 PLE-C4 Pig Liver esterase PLE1

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Sus scrofa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Suina: N E > Suidae: N E > Sus: N E > Sus scrofa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KX577729
1 UniProt : A0A1S6L948
1 UniProt : A0A1S6L948
1 Interpro : A0A1S6L948
1 Prodom : A0A1S6L948
1 Pfam : A0A1S6L948
1 PIRSF : A0A1S6L948
1 SUPERFAM : A0A1S6L948
Sequence
Graphical view for this peptide sequence: pig-a0a1s6l948
Colored MSA for Carb_B_Chordata (raw)
MWLLPLVLTSLASSATWAGQPASPPVVDTAQGRVLGKYVSLEGLAQPVAV
FLGVPFAKPPLRSLRFAPPQPAEPWSFVKNTTSYPPMCCQEPIGEQMLSD
LFTNRKERLTPEFSEDCLYLNIYTPADLTKSGRLPVMVWIHGGGLVVGGA
STYDGLALAAHENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALH
WVQENIANFGGDPGSVTIFGESAGGQSVSVLVLSPLAKNLFHRAISESGV
ALTAGLVRKDMKAAAKQIAVLAGCKTTTSAVFVHCLRQKSEDELLDLTLK
MKFFALDLHGDPRESHPFLTTVVDGVLLPKMPEEILAEKDFNTVPYIVGI
NKQEFGWLLPTMMGFPLFEGKLDQKTATSLLWKSYPIANIPEELTPVATD
KYLGGTDDPVKKKDLFLDLMGDVVFGVPSVTVARQHRDAGAPTYMYEFQY
RPSFSSDKKPKTVIGDHGDELFSVFGAPFLKGDAPEEEVSLSKTVMKFWA
NFARSGNPNGEGLPHWPMYDQEEGYLQIGVNTQAAKRLKGEEVAFWNDLL
SKEAAKKPPKIKHAEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWLLPLVLTSLASSATWAGQPASPPVVDTAQGRVLGKYVSLEGLAQPVAV
FLGVPFAKPPLRSLRFAPPQPAEPWSFVKNTTSYPPMCCQEPIGEQMLSD
LFTNRKERLTPEFSEDCLYLNIYTPADLTKSGRLPVMVWIHGGGLVVGGA
STYDGLALAAHENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALH
WVQENIANFGGDPGSVTIFGESAGGQSVSVLVLSPLAKNLFHRAISESGV
ALTAGLVRKDMKAAAKQIAVLAGCKTTTSAVFVHCLRQKSEDELLDLTLK
MKFFALDLHGDPRESHPFLTTVVDGVLLPKMPEEILAEKDFNTVPYIVGI
NKQEFGWLLPTMMGFPLFEGKLDQKTATSLLWKSYPIANIPEELTPVATD
KYLGGTDDPVKKKDLFLDLMGDVVFGVPSVTVARQHRDAGAPTYMYEFQY
RPSFSSDKKPKTVIGDHGDELFSVFGAPFLKGDAPEEEVSLSKTVMKFWA
NFARSGNPNGEGLPHWPMYDQEEGYLQIGVNTQAAKRLKGEEVAFWNDLL
SKEAAKKPPKIKHAEL


References
    Title: Regioselective ester cleavage of di-(2-ethylhexyl) trimellitates by porcine liver esterase
    Hollerer C, Becker G, Goen T, Eckert E
    Ref: Toxicol In Vitro, 47:178, 2018 : PubMed

            

    Title: Third-Generation Sequencing and Analysis of Four Complete Pig Liver Esterase Gene Sequences in Clones Identified by Screening BAC Library
    Zhou Q, Sun W, Liu X, Wang X, Xiao Y, Bi D, Yin J, Shi D
    Ref: PLoS ONE, 11:e0163295, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer