Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pig-a9gyw6

Sus scrofa (Pig) APLE Alternative Pig Liver Esterase

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Sus scrofa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Suina: N E > Suidae: N E > Sus: N E > Sus scrofa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5FV4: Pig liver esterase 5 (PLE5)
No kinetic





No Substrate
No inhibitor
1 Genbank : AM774149
1 UniProt : A9GYW6
1 Structure : 5FV4
1 UniProt : A9GYW6
1 Interpro : A9GYW6
1 Prodom : A9GYW6
1 Pfam : A9GYW6
1 PIRSF : A9GYW6
1 SUPERFAM : A9GYW6
Sequence
Graphical view for this peptide sequence: pig-a9gyw6
Colored MSA for Carb_B_Chordata (raw)
GQPASPPVVDTAQGRVLGKYVSLEGLAQPVAVFLGVPFAKPPLGSLRFAP
PQPAEPWSFVKNTTSYPPMCCQEPIGGQMLSDLFTNRKERLIPEFSEDCL
YLNIYTPADLTKRGRLPVMVWIHGGGLVVGGASTYDGLALAAHENVVVVA
IQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQENIANFGGDPGSVTI
FGESAGGESVSVLVLSPLAKNLFHRAISESGVAFTAGLVRKDMKAAAKQI
AVLAGCKTTTSAVFVHCLRQKSEDELLDLTLKMKFFALDLHGDPRESHPF
LTTVVDGVLLPKMPEEILAEKDFNTVPYIVGINKQEFGWLLPTMMGFPLS
EGKLDQKTATSLLWKSYPIANIPEELTPVATDKYLGGTDDPVKKKDLFLD
LMGDVVFGVPSVTVARQHRDAGAPTYMYEFQYRPSFSSDKKPKTVIGDHG
DEIFSVFGFPLLKGDAPEEEVSLSKTVMKFWANFARSGNPNGEGLPHWPM
YDQEEGYLQIGVNTQAAKRLKGEEVAFWNDLLSKEAAKKPPKIKHAEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GQPASPPVVDTAQGRVLGKYVSLEGLAQPVAVFLGVPFAKPPLGSLRFAP
PQPAEPWSFVKNTTSYPPMCCQEPIGGQMLSDLFTNRKERLIPEFSEDCL
YLNIYTPADLTKRGRLPVMVWIHGGGLVVGGASTYDGLALAAHENVVVVA
IQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQENIANFGGDPGSVTI
FGESAGGESVSVLVLSPLAKNLFHRAISESGVAFTAGLVRKDMKAAAKQI
AVLAGCKTTTSAVFVHCLRQKSEDELLDLTLKMKFFALDLHGDPRESHPF
LTTVVDGVLLPKMPEEILAEKDFNTVPYIVGINKQEFGWLLPTMMGFPLS
EGKLDQKTATSLLWKSYPIANIPEELTPVATDKYLGGTDDPVKKKDLFLD
LMGDVVFGVPSVTVARQHRDAGAPTYMYEFQYRPSFSSDKKPKTVIGDHG
DEIFSVFGFPLLKGDAPEEEVSLSKTVMKFWANFARSGNPNGEGLPHWPM
YDQEEGYLQIGVNTQAAKRLKGEEVAFWNDLLSKEAAKKPPKIKHAEL


References
    Title: Regioselective ester cleavage of di-(2-ethylhexyl) trimellitates by porcine liver esterase
    Hollerer C, Becker G, Goen T, Eckert E
    Ref: Toxicol In Vitro, 47:178, 2018 : PubMed

            

    Title: Alternative pig liver esterase (APLE) - cloning, identification and functional expression in Pichia pastoris of a versatile new biocatalyst
    Hermann M, Kietzmann MU, Ivancic M, Zenzmaier C, Luiten RG, Skranc W, Wubbolts M, Winkler M, Birner-Gruenberger R and Schwab H <1 more author(s)>
    Ref: J Biotechnol, 133:301, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer