pig-b8xy18

 
Sus scrofa (Pig). Pancreatic lipase

Relationship
Block L
Sus scrofa position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Suina: N E > Suidae: N E > Sus: N E > Sus scrofa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : FJ458419, NP_001136369, AEMK02000096
2 UniProt : B8XY18, F6Q1W0
2 UniProtTrembl : B8XY18, F6Q1W0
2 Interpro : B8XY18, F6Q1W0
2 Prodom : B8XY18, F6Q1W0
2 Pfam : B8XY18, F6Q1W0
2 PIRSF : B8XY18, F6Q1W0
2 SUPERFAM : B8XY18, F6Q1W0
2 QuickSwissBlast : B8XY18, F6Q1W0
 
Sequence
Graphical view for this peptide sequence: pig-b8xy18
Colored MSA for Pancreatic_lipase (raw)
MMNIWTITLFLLGAARANEVCYDSIGCFSDDEPWAGTVIRPLKILPWSPE
KIGTRFLLYTNENPNNFQILLPSDPSTIEASNFQTDRKTRFIIHGFIDKG
DESWLVNMCQNLFEVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQM
LAMLQLNYSYSPSQVHLIGHSLGAHVAGEAGSKTPGLGRITGLDPVEASF
EGTPEEVRLDPSDADFVDVIHTDAASLIPFLGFGTSQQLGHLDFFPNGGE
EMPGCKKNALSQIVDLDGIWSGTRDFVACNHLRSYKYYSESILNPDGFAA
YPCASYRAFESNKCFPCPDEGCPQMGHYADRFAGKTHEEQQKFFLNTGDS
EDFARWRYGVTITLSGRVASGQIKVALFGDKGNTRQYNIFTGIITPGSTH
SNEFDADLDVGTIEKVKFLWNNNVLNPTLPRVGAAKITVQKGEDKTEYNF
CSEQTVREGVLLTLTPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMNIWTITLFLLGAARANEVCYDSIGCFSDDEPWAGTVIRPLKILPWSPE
KIGTRFLLYTNENPNNFQILLPSDPSTIEASNFQTDRKTRFIIHGFIDKG
DESWLVNMCQNLFEVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQM
LAMLQLNYSYSPSQVHLIGHSLGAHVAGEAGSKTPGLGRITGLDPVEASF
EGTPEEVRLDPSDADFVDVIHTDAASLIPFLGFGTSQQLGHLDFFPNGGE
EMPGCKKNALSQIVDLDGIWSGTRDFVACNHLRSYKYYSESILNPDGFAA
YPCASYRAFESNKCFPCPDEGCPQMGHYADRFAGKTHEEQQKFFLNTGDS
EDFARWRYGVTITLSGRVASGQIKVALFGDKGNTRQYNIFTGIITPGSTH
SNEFDADLDVGTIEKVKFLWNNNVLNPTLPRVGAAKITVQKGEDKTEYNF
CSEQTVREGVLLTLTPC

no DNA




Reference
    Title: Pancreatic lipase-related protein 1 (PLRP1) is present in the pancreatic juice of several species
    De Caro J, Carriere F, Barboni P, Giller T, Verger R, de Caro A
    Ref: Biochimica & Biophysica Acta, 1387:331, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer