Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pinra-PrMC3

Pinus radiata PrMC3

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Pinus radiata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Acrogymnospermae: N E > Pinidae: N E > Pinales: N E > Pinaceae: N E > Pinus [genus]: N E > Pinus [subgenus]: N E > Pinus radiata: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF110333, AAF62404
1 Ncbi-nid : 5487872
1 Ncbi-pid : 5487873
1 UniProt : Q9ZSE0
1 Interpro : Q9ZSE0
1 Prodom : Q9ZSE0
1 Pfam : Q9ZSE0
1 PIRSF : Q9ZSE0
1 SUPERFAM : Q9ZSE0
Sequence
Graphical view for this peptide sequence: pinra-PrMC3
Colored MSA for Plant_carboxylesterase (raw)
MEITHTLLEDVPGFIQVYEDGFVARFDHRLTPASPQVASDGARSKDVVID
PVKGISARLFLPAELPLAQKLPLLFYFHGGGFCIGTTAWEGYHLFLSLLA
ATTRALVISVDYRLAPEHRLPAAYDDCFDAVEWVASGGGKAEPWLDAHAD
YGRCFLAGESAGGNIAHVVGSRTADQDLGPLKIRGLIVIHPYFGSEERIE
CEKVAAGDDAAALELNDLFWRLALPPGSDRDYPTCNPRGPRSADLRKVPL
PPVLVTVAGLDLLKTRGLLYYELLQSCGKEAELMEAEGEIHAYHVFHPRS
EATRLLQERMSQFIHRFDA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEITHTLLEDVPGFIQVYEDGFVARFDHRLTPASPQVASDGARSKDVVID
PVKGISARLFLPAELPLAQKLPLLFYFHGGGFCIGTTAWEGYHLFLSLLA
ATTRALVISVDYRLAPEHRLPAAYDDCFDAVEWVASGGGKAEPWLDAHAD
YGRCFLAGESAGGNIAHVVGSRTADQDLGPLKIRGLIVIHPYFGSEERIE
CEKVAAGDDAAALELNDLFWRLALPPGSDRDYPTCNPRGPRSADLRKVPL
PPVLVTVAGLDLLKTRGLLYYELLQSCGKEAELMEAEGEIHAYHVFHPRS
EATRLLQERMSQFIHRFDA


References
    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            

    Title: Genes expressed in Pinus radiata male cones include homologs to anther-specific and pathogenesis response genes
    Walden AR, Walter C, Gardner RC
    Ref: Plant Physiol, 121:1103, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer