Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: plafa-PF13.0153

Plasmodium falciparum (isolate 3D7) PF3D7_1328500 hypothetical protein

Comment
only the central part 468-685 is homologous long NNN repeats at both ends


Relationship
Family|Plasmodium_subtelomeric_PST-A
Block| X
Position in NCBI Life Tree|Plasmodium falciparum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Haemosporida: N E > Plasmodiidae: N E > Plasmodium: N E > Plasmodium (Laverania): N E > Plasmodium falciparum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
2 inhibitors: Sal-A-alkyne, Salinipostin-A
>3 Genbank links 1 more: AL844509, CAD52421, XP_001350013
1 UniProt : A0A5K1K859
1 Interpro : A0A5K1K859
1 Prodom : A0A5K1K859
1 Pfam : A0A5K1K859
1 PIRSF : A0A5K1K859
1 SUPERFAM : A0A5K1K859
Sequence
Graphical view for this peptide sequence: plafa-PF13.0153
Colored MSA for Plasmodium_subtelomeric_PST-A (raw)
YDGCNDNTVYYCSMCGSVCNYCNCGERTLSYKNSWIEKLNENNFSFFGID
NQSHGLSEGSRNQRCFVEDFEHFISDAIQALEIFINEWKEKNEMKPIILM
GLSMGGCIALRTLETINRLNKEWKSYVKCLILVSPMISLGKQKNKISNKL
LISATKFLKYFFPLLKVNVKESNAKYAWIKHDSDIDPFQYCGPLNIKIAA
ECVSAADNCLKYHILKYVEESDTDIMVIQSKHDCIVDPSGSIDFMKKMVR
LYNKKEEKRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

YDGCNDNTVYYCSMCGSVCNYCNCGERTLSYKNSWIEKLNENNFSFFGID
NQSHGLSEGSRNQRCFVEDFEHFISDAIQALEIFINEWKEKNEMKPIILM
GLSMGGCIALRTLETINRLNKEWKSYVKCLILVSPMISLGKQKNKISNKL
LISATKFLKYFFPLLKVNVKESNAKYAWIKHDSDIDPFQYCGPLNIKIAA
ECVSAADNCLKYHILKYVEESDTDIMVIQSKHDCIVDPSGSIDFMKKMVR
LYNKKEEKRL


References
    Title: The Antimalarial Natural Product Salinipostin A Identifies Essential alpha/beta Serine Hydrolases Involved in Lipid Metabolism in P. falciparum Parasites
    Yoo E, Schulze CJ, Stokes BH, Onguka O, Yeo T, Mok S, Gnadig NF, Zhou Y, Kurita K and Bogyo M <11 more author(s)>
    Ref: Cell Chemical Biology, 27:143, 2020 : PubMed

            

    Title: Functional annotation of serine hydrolases in the asexual erythrocytic stage of Plasmodium falciparum
    Elahi R, Ray WK, Dapper C, Dalal S, Helm RF, Klemba M
    Ref: Sci Rep, 9:17532, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer