Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: plafa-a0a143zya4

Plasmodium falciparum (isolate 3D7) PF3D7_0818600 BEM46-like protein, putative

Comment
A study of PBLP in the rodent malaria parasite Plasmodium yoelii showed that it has an important role in invasion. Deletion of PBLP affects merozoite formation, sporozoite maturation, and infectivity


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Plasmodium falciparum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Haemosporida: N E > Plasmodiidae: N E > Plasmodium: N E > Plasmodium (Laverania): N E > Plasmodium falciparum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CZT62756, AL844507
1 UniProt : A0A143ZYA4
1 UniProt : A0A143ZYA4
1 Interpro : A0A143ZYA4
1 Prodom : A0A143ZYA4
1 Pfam : A0A143ZYA4
1 PIRSF : A0A143ZYA4
1 SUPERFAM : A0A143ZYA4
Sequence
Graphical view for this peptide sequence: plafa-a0a143zya4
Colored MSA for ABHD13-BEM46 (raw)
MRIIKYIFFAFIILALFVCALNTYIYLKQDSFVFSNEFPTVEEKNQTLGE
NYEIVTLTTKDNHKFTCWYIKTKDSENKPIMLYFQGNGGYLEKYMNLFNL
IIERVDVNIFSCSNRGCGSNIAKPSEEYFYKDAHVYIEYVKTKNPKHLFI
FGSSMGAAVAIDTALKQHDHISGLIVQNAFTSLKELSRYSHPFLNYFLFD
YDMIIRSKMDNETKIKNITVPTLFTLSEMDEKVPTSHTRTLFQLSASTNK
QLYLSKGGTHPNILKNDDGSYHKAMKKFIVTAISIREKNIQKAVERNPNT
PN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRIIKYIFFAFIILALFVCALNTYIYLKQDSFVFSNEFPTVEEKNQTLGE
NYEIVTLTTKDNHKFTCWYIKTKDSENKPIMLYFQGNGGYLEKYMNLFNL
IIERVDVNIFSCSNRGCGSNIAKPSEEYFYKDAHVYIEYVKTKNPKHLFI
FGSSMGAAVAIDTALKQHDHISGLIVQNAFTSLKELSRYSHPFLNYFLFD
YDMIIRSKMDNETKIKNITVPTLFTLSEMDEKVPTSHTRTLFQLSASTNK
QLYLSKGGTHPNILKNDDGSYHKAMKKFIVTAISIREKNIQKAVERNPNT
PN


References
    Title: The Antimalarial Natural Product Salinipostin A Identifies Essential alpha/beta Serine Hydrolases Involved in Lipid Metabolism in P. falciparum Parasites
    Yoo E, Schulze CJ, Stokes BH, Onguka O, Yeo T, Mok S, Gnadig NF, Zhou Y, Kurita K and Bogyo M <11 more author(s)>
    Ref: Cell Chemical Biology, 27:143, 2020 : PubMed

            

    Title: Functional annotation of serine hydrolases in the asexual erythrocytic stage of Plasmodium falciparum
    Elahi R, Ray WK, Dapper C, Dalal S, Helm RF, Klemba M
    Ref: Sci Rep, 9:17532, 2019 : PubMed

            

    Title: A Plasmodium alpha/beta-hydrolase modulates the development of invasive stages
    Groat-Carmona AM, Kain H, Brownell J, Douglass AN, Aly AS, Kappe SH
    Ref: Cell Microbiol, 17:1848, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer