Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: plebo-pip

Plectonema boryanum ORF270, proline iminopeptidase

Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Plectonema boryanum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Synechococcales: N E > Leptolyngbyaceae: N E > Leptolyngbya: N E > Leptolyngbya boryana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB017194
1 UniProt : O83041
1 Ncbi-nid : 3513355
1 Ncbi-pid : 3513357
1 UniProt : O83041
1 Interpro : O83041
1 Prodom : O83041
1 Pfam : O83041
1 PIRSF : O83041
1 SUPERFAM : O83041
Sequence
Graphical view for this peptide sequence: plebo-pip
Colored MSA for Proline_iminopeptidase (raw)
MRQLYPAIAPYQSGMLPVSALHTIYYEQSGNPNGKPVVFLHGGPGGGTIP
TYRQYFDPSKWRIILFDQRGAGKSTPHAELRENTTWDLVSDIEKLRSHLN
IDRWFVFGGSWGSTLSLAYSQTHPDRCLGLILRGIFLLRRKEILWFYQDG
ASWIFPDAWEHYLEPIPPEERDDMISAYYRRLTSKDAEIRSTAAKAWSVW
EGTTSRLIVDPSLQSKFADDEFADAFARIECHYFINRGFFETDDQLLQNC
DRIAHIPTVIVQGRYDVVCPMTSAWALHKALPESELIVVPDAGHSMMEAG
ILSALIDATDRFVAQKTNGKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRQLYPAIAPYQSGMLPVSALHTIYYEQSGNPNGKPVVFLHGGPGGGTIP
TYRQYFDPSKWRIILFDQRGAGKSTPHAELRENTTWDLVSDIEKLRSHLN
IDRWFVFGGSWGSTLSLAYSQTHPDRCLGLILRGIFLLRRKEILWFYQDG
ASWIFPDAWEHYLEPIPPEERDDMISAYYRRLTSKDAEIRSTAAKAWSVW
EGTTSRLIVDPSLQSKFADDEFADAFARIECHYFINRGFFETDDQLLQNC
DRIAHIPTVIVQGRYDVVCPMTSAWALHKALPESELIVVPDAGHSMMEAG
ILSALIDATDRFVAQKTNGKI


Reference
    Title: Differential electron flow around photosystem I by two C(4)-photosynthetic-cell-specific ferredoxins
    Kimata-Ariga Y, Matsumura T, Kada S, Fujimoto H, Fujita Y, Endo T, Mano J, Sato F, Hase T
    Ref: EMBO Journal, 19:5041, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer