Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pluxy-PxalphaE14

Plutella xylostella (Diamondback moth) (Plutella maculipennis) Carboxylic ester hydrolase PxalphaE14

Comment
PxalphaE14, was found significantly overexpressed in a field-evolved multiresistant P. xylostella, Knockdown of PxalphaE14 dramatically increased the susceptibility of the larvae to beta-cypermethrin, bifenthrin, chlorpyrifos, fenvalerate, malathion, and phoxim. Overexpression increased resistance


Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Plutella xylostella
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Yponomeutoidea: N E > Plutellidae: N E > Plutella: N E > Plutella xylostella: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Fenvalerate
No inhibitor
3 Genbank : XM_011551778, JAV02097, XP_011550080
1 UniProt : A0A1L8D6V2
1 Interpro : A0A1L8D6V2
1 Pfam : A0A1L8D6V2
1 PIRSF : A0A1L8D6V2
1 SUPERFAM : A0A1L8D6V2
Sequence
Graphical view for this peptide sequence: pluxy-PxalphaE14
Colored MSA for Carb_B_Arthropoda (raw)
MGENTVGERVRVVTKEGPVIGSLEERDGKNLYSFYRVPYGTPPLGQLRFS
APKPAAPWQEDIDCTKKVCGPVTGAELVTKCCLLNEDCLYVHIVTRDLNP
VKPKPVMFWIGCFNYCWSLNILLEPCILVDEDVVFVTCSFRAGPMGFLSI
QNVVAPGNAGLKDIVMGLKWVQRNISLFGGDPNNVTLFGSSTGGAIVHLM
MLSSMTEGLFHKAIIQSASALNNWALTKNPAAAVVELAKALGIEVIGNDY
AEIVEILKTLPAEDIVKAFLDKIAVVEDATDIFNPMFRPCIEEDFEGHTA
FLSKSPFLILKSGKFNKVPMIIGGDNIETSLLKFLKYNFSENYEQLNQRS
SFTLPKQMASGMNSLSTKLVQQLINFYTGEDAELSDGTKHQYLQMISDYY
FLYCVNKSVRFHARWAAESPVYYYVLNFSGDWSVPHELCYMNCGEIPYMF
QIRLPAEDRYARGGRDSVRVRSRVIKMWTNFAKYGNPTPDDNDPLFHITW
DPVENEDRLNYLAIGTELTKGRNPYYDRMKFWDQLFVEQSFLRTLMYFND
MGVQW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGENTVGERVRVVTKEGPVIGSLEERDGKNLYSFYRVPYGTPPLGQLRFS
APKPAAPWQEDIDCTKKVCGPVTGAELVTKCCLLNEDCLYVHIVTRDLNP
VKPKPVMFWIGCFNYCWSLNILLEPCILVDEDVVFVTCSFRAGPMGFLSI
QNVVAPGNAGLKDIVMGLKWVQRNISLFGGDPNNVTLFGSSTGGAIVHLM
MLSSMTEGLFHKAIIQSASALNNWALTKNPAAAVVELAKALGIEVIGNDY
AEIVEILKTLPAEDIVKAFLDKIAVVEDATDIFNPMFRPCIEEDFEGHTA
FLSKSPFLILKSGKFNKVPMIIGGDNIETSLLKFLKYNFSENYEQLNQRS
SFTLPKQMASGMNSLSTKLVQQLINFYTGEDAELSDGTKHQYLQMISDYY
FLYCVNKSVRFHARWAAESPVYYYVLNFSGDWSVPHELCYMNCGEIPYMF
QIRLPAEDRYARGGRDSVRVRSRVIKMWTNFAKYGNPTPDDNDPLFHITW
DPVENEDRLNYLAIGTELTKGRNPYYDRMKFWDQLFVEQSFLRTLMYFND
MGVQW


Reference
    Title: Overexpression of PxalphaE14 Contributing to Detoxification of Multiple Insecticides in Plutella xylostella (L.)
    Li R, Zhu B, Hu XP, Shi XY, Qi LL, Liang P, Gao XW
    Ref: Journal of Agricultural and Food Chemistry, 70:5794, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer