Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: proaa-e4aeq3

Propionibacterium acnes, Hydrolase, alpha/beta fold family protein

Comment
Other strains: Propionibacterium acnes (strains: HL037PA3; HL037PA2; HL044PA1)


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Propionibacterium acnes HL037PA3
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Cutibacterium: N E > [Propionibacterium] humerusii: N E > [Propionibacterium] humerusii HL037PA3: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : ADXV01000029, ADYH01000021, ADZU01000011
1 UniProt : E4HHT8
1 UniProt : E4HHT8
1 Interpro : E4HHT8
1 Prodom : E4HHT8
1 Pfam : E4HHT8
1 PIRSF : E4HHT8
1 SUPERFAM : E4HHT8
Sequence
Graphical view for this peptide sequence: proaa-e4aeq3
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MDTITITADDGADIDVLVWRPQGGGVRPIKGLVQLCHGMAEYAARYDEVA
RFLADDGWLVVANDHRGHGPRAAAMRELGTTPDRGYHQLLDDLSAVADHF
LAEVEGKPWFLVGHSMGSFLARVLAARRGREMAGLVAIGTGSSLGPLSTV
ATGLAQTQVLMLGEDSRSPLLDTLSFGSFNRAFYPARTDYDWLSRDVHVV
DAYVDDPLCGFVCTAAFYRELVRLIQLANSTEVFRATPPALPVLLMSGAK
DPVGDSGRGVRRVAHQLRDSGSREVDVILYPGGRHEVLNEVNRRHVHAHL
WEWINTVAIRPRTPQARKAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDTITITADDGADIDVLVWRPQGGGVRPIKGLVQLCHGMAEYAARYDEVA
RFLADDGWLVVANDHRGHGPRAAAMRELGTTPDRGYHQLLDDLSAVADHF
LAEVEGKPWFLVGHSMGSFLARVLAARRGREMAGLVAIGTGSSLGPLSTV
ATGLAQTQVLMLGEDSRSPLLDTLSFGSFNRAFYPARTDYDWLSRDVHVV
DAYVDDPLCGFVCTAAFYRELVRLIQLANSTEVFRATPPALPVLLMSGAK
DPVGDSGRGVRRVAHQLRDSGSREVDVILYPGGRHEVLNEVNRRHVHAHL
WEWINTVAIRPRTPQARKAR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer