Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: proaa-e4ca04

Propionibacterium acnes, Acetyl xylan esterase (AXE1)

Comment
Other strains: Propionibacterium acnes (HL036PA1; J139; HL060PA1; HL030PA1; HL001PA1; HL050PA2; HL110PA3; HL110PA4; HL025PA1; HL103PA1; HL002PA1; HL030PA2; SK187; HL072PA2; HL007PA1; HL110PA1; HL056PA1; HL027PA2; HL050PA1; HL027PA1; HL036PA2; HL005PA1; HL013PA1; HL043PA2; HL074PA1; HL110PA2; HL053PA1; HL053PA2; HL037PA1; HL005PA3; HL005PA3; J165; HL059PA1; HL005PA2; HL002PA3; HL045PA1; HL067PA1; HL092PA1; HL059PA2; HL063PA2; HL078PA1; HL096PA2; HL063PA1; HL038PA1; HL083PA1; SK137; HL072PA1; HL087PA2; HL097PA1; HL002PA2; HL036PA3; HL046PA1; HL046PA2; HL050PA3; HL087PA3; HL083PA2; HL043PA1; HL013PA2; HL005PA4; HL096PA3; HL086PA1; HL050PA2; HL110PA4; HL110PA3; HL060PA1; HL082PA2; HL025PA1; HL001PA1; HL030PA1; HL082PA1; HL082PA2; HL103PA1; HL060PA1; HL001PA1; HL030PA1; HL110PA4; J139; HL050PA2; HL110PA3; HL025PA1)


Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Propionibacterium acnes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Cutibacterium: N E > Cutibacterium acnes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 59 more: ADYL01000002, ADFS01000001, ADYE01000019
>3 UniProt links 2 more: D1Y9N9, E6D7U9, E6D7V0
>3 UniProt links 2 more: D1Y9N9, E6D7U9, E6D7V0
>3 Interpro links 2 more: D1Y9N9, E6D7U9, E6D7V0
>3 Prodom links 2 more: D1Y9N9, E6D7U9, E6D7V0
>3 Pfam links 2 more: D1Y9N9, E6D7U9, E6D7V0
>3 PIRSF links 2 more: D1Y9N9, E6D7U9, E6D7V0
>3 SUPERFAM links 2 more: D1Y9N9, E6D7U9, E6D7V0
Sequence
Graphical view for this peptide sequence: proaa-e4ca04
Colored MSA for Acetyl-esterase_deacetylase (raw)
MPLTDLGIDEARTYRPNVPEPDGFDSFWAETLDEYSGVPQDLTAVPFDNR
QALIDTWDLSWAGYHNSRVSGWLHAPAAVNGPLPLVIEYLGYSSSRGVPI
GSVFAAAGYAHIVVDPRGQGWGHPTLTENCPDVHDGSGAPGFMTQSLSDP
HGHYYRRLFTDAFRCLQAAREMELVDPTRIAVLGHSQGGGQAIAVCALAA
MRGIKLAGAFVDVPFLCHIRRSCDIATDGPYLEVVRYLAAHPSLCGRAFQ
TLGYFDGLHFARRARTSTWFSVAMMDQAVPPSSVWAAYNAWGDGMVADKH
IAVYPFAGHAAGEDVQRWNQLGVLAQLFS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLTDLGIDEARTYRPNVPEPDGFDSFWAETLDEYSGVPQDLTAVPFDNR
QALIDTWDLSWAGYHNSRVSGWLHAPAAVNGPLPLVIEYLGYSSSRGVPI
GSVFAAAGYAHIVVDPRGQGWGHPTLTENCPDVHDGSGAPGFMTQSLSDP
HGHYYRRLFTDAFRCLQAAREMELVDPTRIAVLGHSQGGGQAIAVCALAA
MRGIKLAGAFVDVPFLCHIRRSCDIATDGPYLEVVRYLAAHPSLCGRAFQ
TLGYFDGLHFARRARTSTWFSVAMMDQAVPPSSVWAAYNAWGDGMVADKH
IAVYPFAGHAAGEDVQRWNQLGVLAQLFS



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer