Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: proac-q6a5w4

Propionibacterium acnes putative lysophospholipase

Comment
Other strains: Propionibacterium acnes (HL110PA1; HL082PA2; HL037PA2; HL110PA4; HL037PA3; HL103PA1; HL060PA1; HL050PA2; HL044PA1; HL001PA1; HL110PA3; J139; HL030PA1; HL097PA1)


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Propionibacterium acnes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Cutibacterium: N E > Cutibacterium acnes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AE017283, ADZE01000005
>3 UniProt links 1 more: Q6A5W4, E6D4M7, E4HJJ6
>3 UniProt links 1 more: Q6A5W4, E6D4M7, E4HJJ6
>3 Interpro links 1 more: Q6A5W4, E6D4M7, E4HJJ6
>3 Prodom links 1 more: Q6A5W4, E6D4M7, E4HJJ6
>3 Pfam links 1 more: Q6A5W4, E6D4M7, E4HJJ6
>3 PIRSF links 1 more: Q6A5W4, E6D4M7, E4HJJ6
>3 SUPERFAM links 1 more: Q6A5W4, E6D4M7, E4HJJ6
Sequence
Graphical view for this peptide sequence: proac-q6a5w4
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MTFTKKLSALAIAGTMAITGASIATVPAVAADKAPAPATATVQSKLITGY
TTSTDQWGTKLFFRKNIVPNAKGAVVIVHGAAEHSGRYDYLAKRLNDAGY
STYRFDHRGHGRSARPYVDNAIPRGHIDDWSNLVNDVHQFVQIAHQENAG
KKVFLFGHSMGSFAVQSYGAKYPGTVAGIVSNGGGIAVNPWGRDTEGPEK
VTAHDLTDAEKNAAPTISQLLPMDKLTSFNGILLTQAVRHPKAIHLPSTA
AEAFIQFKNPLANGVCTDPAVIEDYKKDPLNNKYMSLGMVKQMGVAQVYN
TFNAPSFSEPTLIMHGANDGIVPSYFDVNWYNAIGSKDKKIIEWEGLMHE
TINEPVKDQVDDTIINWINAHNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTFTKKLSALAIAGTMAITGASIATVPAVAADKAPAPATATVQSKLITGY
TTSTDQWGTKLFFRKNIVPNAKGAVVIVHGAAEHSGRYDYLAKRLNDAGY
STYRFDHRGHGRSARPYVDNAIPRGHIDDWSNLVNDVHQFVQIAHQENAG
KKVFLFGHSMGSFAVQSYGAKYPGTVAGIVSNGGGIAVNPWGRDTEGPEK
VTAHDLTDAEKNAAPTISQLLPMDKLTSFNGILLTQAVRHPKAIHLPSTA
AEAFIQFKNPLANGVCTDPAVIEDYKKDPLNNKYMSLGMVKQMGVAQVYN
TFNAPSFSEPTLIMHGANDGIVPSYFDVNWYNAIGSKDKKIIEWEGLMHE
TINEPVKDQVDDTIINWINAHNK


Reference
    Title: The complete genome sequence of Propionibacterium acnes, a commensal of human skin
    Bruggemann H, Henne A, Hoster F, Liesegang H, Wiezer A, Strittmatter A, Hujer S, Durre P, Gottschalk G
    Ref: Science, 305:671, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer