(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Actinobacteria [phylum]: NE > Actinobacteria [class]: NE > Propionibacteriales: NE > Propionibacteriaceae: NE > Cutibacterium: NE > Cutibacterium acnes: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Propionibacterium acnes J139: N, E.
Cutibacterium acnes HL110PA4: N, E.
Propionibacterium acnes SK137: N, E.
Propionibacterium acnes SK187: N, E.
Propionibacterium acnes J165: N, E.
Propionibacterium acnes HL046PA2: N, E.
Propionibacterium acnes JCM 18909: N, E.
Propionibacterium acnes HL083PA2: N, E.
Propionibacterium acnes HL053PA1: N, E.
Propionibacterium acnes HL063PA1: N, E.
Propionibacterium acnes HL063PA2: N, E.
Propionibacterium acnes HL025PA1: N, E.
Propionibacterium acnes HL005PA2: N, E.
Propionibacterium acnes HL036PA1: N, E.
Propionibacterium acnes HL086PA1: N, E.
Propionibacterium acnes HL027PA2: N, E.
Propionibacterium acnes HL037PA1: N, E.
Propionibacterium acnes HL013PA1: N, E.
Propionibacterium acnes 266: N, E.
Propionibacterium acnes HL092PA1: N, E.
Propionibacterium acnes TypeIA2 P.acn31: N, E.
Propionibacterium acnes HL046PA1: N, E.
Propionibacterium acnes HL087PA2: N, E.
Propionibacterium acnes HL002PA1: N, E.
Propionibacterium acnes HL030PA1: N, E.
Propionibacterium acnes HL096PA1: N, E.
Propionibacterium acnes HL056PA1: N, E.
Propionibacterium acnes HL002PA2: N, E.
Propionibacterium acnes HL110PA3: N, E.
Propionibacterium acnes HL096PA3: N, E.
Propionibacterium acnes HL110PA1: N, E.
Propionibacterium acnes PRP-38: N, E.
Propionibacterium acnes HL050PA3: N, E.
Propionibacterium acnes HL060PA1: N, E.
Propionibacterium acnes HL036PA3: N, E.
Propionibacterium acnes HL050PA1: N, E.
Propionibacterium acnes HL099PA1: N, E.
Propionibacterium acnes HL042PA3: N, E.
Propionibacterium acnes HL072PA1: N, E.
Propionibacterium acnes HL020PA1: N, E.
Propionibacterium acnes SK182: N, E.
Propionibacterium acnes HL030PA2: N, E.
Propionibacterium acnes HL002PA3: N, E.
Propionibacterium acnes HL078PA1: N, E.
Propionibacterium acnes HL059PA2: N, E.
Propionibacterium acnes ATCC 11828: N, E.
Propionibacterium acnes HL082PA2: N, E.
Propionibacterium acnes HL025PA2: N, E.
Propionibacterium acnes PA2: N, E.
Propionibacterium acnes HL072PA2: N, E.
Propionibacterium acnes HL050PA2: N, E.
Propionibacterium acnes HL087PA1: N, E.
Propionibacterium acnes HL083PA1: N, E.
Propionibacterium acnes HL097PA1: N, E.
Propionibacterium acnes JCM 18916: N, E.
Propionibacterium acnes JCM 18920: N, E.
Propionibacterium acnes HL103PA1: N, E.
Propionibacterium acnes HL082PA1: N, E.
Propionibacterium acnes HL045PA1: N, E.
Propionibacterium acnes HL005PA1: N, E.
Propionibacterium acnes P6: N, E.
Propionibacterium acnes HL110PA4: N, E.
Propionibacterium acnes HL110PA2: N, E.
Propionibacterium acnes HL067PA1: N, E.
Propionibacterium acnes HL043PA1: N, E.
Propionibacterium acnes JCM 18918: N, E.
Propionibacterium acnes KPA171202: N, E.
Propionibacterium acnes HL059PA1: N, E.
Propionibacterium acnes 6609: N, E.
Propionibacterium acnes HL036PA2: N, E.
Propionibacterium acnes HL043PA2: N, E.
Propionibacterium acnes HL027PA1: N, E.
Propionibacterium acnes HL005PA3: N, E.
Propionibacterium acnes HL087PA3: N, E.
Propionibacterium acnes HL005PA4: N, E.
Propionibacterium acnes HL007PA1: N, E.
Propionibacterium acnes C1: N, E.
Propionibacterium acnes HL001PA1: N, E.
Propionibacterium acnes FZ1/2/0: N, E.
Propionibacterium acnes HL013PA2: N, E.
Propionibacterium acnes HL074PA1: N, E.
Propionibacterium acnes TypeIA2 P.acn17: N, E.
Propionibacterium acnes HL038PA1: N, E.
Propionibacterium acnes HL053PA2: N, E.
Propionibacterium acnes TypeIA2 P.acn33: N, E.
Propionibacterium acnes HL096PA2: N, E.
Cutibacterium acnes HL201PA1: N, E.
Propionibacterium sp. 434-HC2: N, E.
Propionibacterium sp. CC003-HC2: N, E.
Propionibacterium sp. 5_U_42AFAA: N, E.
Propionibacterium acnes HL037PA2: N, E.
Propionibacterium humerusii HL037PA2: N, E.
[Propionibacterium] namnetense SK182B-JCVI: N, E.
Propionibacterium acnes SK182B-JCVI: N, E.
Propionibacterium acnes HL037PA3: N, E.
Propionibacterium humerusii HL037PA3: N, E.
Propionibacterium acnes HL044PA1: N, E.
Propionibacterium humerusii HL044PA1: N, E.
Propionibacterium sp. 409-HC1: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MGWDSTPVSSDMAARMDCASVMFVGVRGSGETPPYGDTITSIRDALAQKW RGKGTVRQVYLNYPAADPHTLQNTPMSSLLFDSTMPSTEYFDSAALGAKK LIALLNTEKKQCPKEWVVLAGFSQGSQAITQALAQTDTPQRLAGAILVGN PDHYPGQNVQEVSGDADQSAIGMAAILYYLRERANATPGANRDAQMRAII EATLSLSQNSINQKALDADMSKAGAAIPAEAYPETYSVCMKGDPVCDTAP ALTRILTLQSTWQDELNQGRPIHMGYTRTVMEGALDRIAQRINAIGAAEA KGTPLPHGSTVAVTTRDWGPLQIGVAVGAGVAGLGAGWLLGRAGRRRQRR RRWH
Propionibacterium acnes is an anaerobic Gram-positive bacterium that has been linked to a wide range of opportunistic human infections and conditions, most notably acne vulgaris (I. Kurokawa et al., Exp. Dermatol. 18:821-832, 2009). We now present the whole-genome sequences of three P. acnes strains from the type IA(2) cluster which were recovered from ophthalmic infections (A. McDowell et al., Microbiology 157:1990-2003, 2011).
Propionibacterium acnes is an anaerobic Gram-positive bacterium that forms part of the normal human cutaneous microbiota and is thought to play a central role in acne vulgaris, a chronic inflammatory disease of the pilosebaceous unit (I. Kurokawa et al., Exp. Dermatol. 18:821-832, 2009). Here we present the whole genome sequence of P. acnes type IB strain 6609, which was recovered from a skin sample from a woman with no recorded acne history and is thus considered a nonpathogenic strain (I. Nagy, Microbes Infect. 8:2195-2205, 2006).
Propionibacterium acnes is a major inhabitant of adult human skin, where it resides within sebaceous follicles, usually as a harmless commensal although it has been implicated in acne vulgaris formation. The entire genome sequence of this Gram-positive bacterium encodes 2333 putative genes and revealed numerous gene products involved in degrading host molecules, including sialidases, neuraminidases, endoglycoceramidases, lipases, and pore-forming factors. Surface-associated and other immunogenic factors have been identified, which might be involved in triggering acne inflammation and other P. acnes-associated diseases.
Propionibacterium acnes is an anaerobic Gram-positive bacterium that forms part of the normal human cutaneous microbiota and is occasionally associated with inflammatory diseases (I. Kurokawa et al., Exp. Dermatol. 18:821-832, 2009). Here we present the complete genome sequence for the commercially available P. acnes type II reference strain ATCC 11828 (I. Nagy et al., Microbes Infect. 8:2195-2205, 2006) recovered from a subcutaneous abscess.
Propionibacterium acnes, a non-spore-forming, anaerobic gram-positive bacterium, is most notably recognized for its association with acne vulgaris (I. Kurokawa et al., Exp. Dermatol. 18:821-832, 2009). We now present the draft genome sequence of an antibiotic-resistant P. acnes strain, PRP-38, isolated from an acne patient in the United Kingdom and belonging to the novel type IC cluster.
Propionibacterium acnes is an anaerobic Gram-positive bacterium that has been linked to a wide range of opportunistic human infections and conditions, most notably acne vulgaris (I. Kurokawa et al., Exp. Dermatol. 18:821-832, 2009). We now present the whole-genome sequences of three P. acnes strains from the type IA(2) cluster which were recovered from ophthalmic infections (A. McDowell et al., Microbiology 157:1990-2003, 2011).
The anaerobic gram-positive bacterium Propionibacterium acnes is a human skin commensal that is occasionally associated with inflammatory diseases. Recent work has indicated that evolutionary distinct lineages of P. acnes play etiologic roles in disease while others are associated with maintenance of skin homeostasis. To shed light on the molecular basis for differential strain properties, we carried out genomic and transcriptomic analysis of distinct P. acnes strains. We sequenced the genome of the P. acnes strain 266, a type I-1a strain. Comparative genome analysis of strain 266 and four other P. acnes strains revealed that overall genome plasticity is relatively low; however, a number of island-like genomic regions, encoding a variety of putative virulence-associated and fitness traits differ between phylotypes, as judged from PCR analysis of a collection of P. acnes strains. Comparative transcriptome analysis of strains KPA171202 (type I-2) and 266 during exponential growth revealed inter-strain differences in gene expression of transport systems and metabolic pathways. In addition, transcript levels of genes encoding possible virulence factors such as dermatan-sulphate adhesin, polyunsaturated fatty acid isomerase, iron acquisition protein HtaA and lipase GehA were upregulated in strain 266. We investigated differential gene expression during exponential and stationary growth phases. Genes encoding components of the energy-conserving respiratory chain as well as secreted and virulence-associated factors were transcribed during the exponential phase, while the stationary growth phase was characterized by upregulation of genes involved in stress responses and amino acid metabolism. Our data highlight the genomic basis for strain diversity and identify, for the first time, the actively transcribed part of the genome, underlining the important role growth status plays in the inflammation-inducing activity of P. acnes. We argue that the disease-causing potential of different P. acnes strains is not only determined by the phylotype-specific genome content but also by variable gene expression.
Propionibacterium acnes is an anaerobic Gram-positive bacterium that forms part of the normal human cutaneous microbiota and is thought to play a central role in acne vulgaris, a chronic inflammatory disease of the pilosebaceous unit (I. Kurokawa et al., Exp. Dermatol. 18:821-832, 2009). Here we present the whole genome sequence of P. acnes type IB strain 6609, which was recovered from a skin sample from a woman with no recorded acne history and is thus considered a nonpathogenic strain (I. Nagy, Microbes Infect. 8:2195-2205, 2006).
Propionibacterium acnes is a major inhabitant of adult human skin, where it resides within sebaceous follicles, usually as a harmless commensal although it has been implicated in acne vulgaris formation. The entire genome sequence of this Gram-positive bacterium encodes 2333 putative genes and revealed numerous gene products involved in degrading host molecules, including sialidases, neuraminidases, endoglycoceramidases, lipases, and pore-forming factors. Surface-associated and other immunogenic factors have been identified, which might be involved in triggering acne inflammation and other P. acnes-associated diseases.
