Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: proac-q6a6d0

Propionibacterium acnes Putative lysophospholipase

Comment
Other strains: Propionibacterium acnes (strain KPA171202 / DSM 16379; HL025PA1 HL078PA1 HL036PA2 HL038PA1 HL037PA1 HL097PA1 HL087PA3 HL096PA3 HL083PA2 HL072PA2 HL002PA2 HL096PA2 HL059PA2 HL056PA1 HL002PA1 HL045PA1 HL050PA1 HL053PA1 HL083PA1 HL067PA1 HL030PA1 HL043PA2 SK187 SK137 HL087PA2 HL027PA2 HL046PA2 HL005PA1 HL027PA1 HL072PA1 HL005PA4 HL013PA2 HL007PA1 HL086PA1 J165 HL005PA3 HL046PA1 HL002PA3 HL036PA3 HL005PA2 HL013PA1 HL050PA3 HL043PA1 HL074PA1 HL063PA1 HL036PA1 HL059PA1 HL110PA1 HL082PA1 HL092PA1 HL110PA2 HL053PA2 HL030PA2 HL063PA2 HL110PA4 HL110PA3 HL037PA3 HL037PA2 HL044PA1 HL060PA1 HL001PA1 HL082PA2 J139 HL050PA2 HL103PA1)


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Propionibacterium acnes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Cutibacterium: N E > Cutibacterium acnes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 63 more: AE017283, ADYQ01000007, ADZG01000049
>3 UniProt links 1 more: Q6A6D0, E6D6I8, E4HN45
>3 UniProt links 1 more: Q6A6D0, E6D6I8, E4HN45
>3 Interpro links 1 more: Q6A6D0, E6D6I8, E4HN45
>3 Prodom links 1 more: Q6A6D0, E6D6I8, E4HN45
>3 Pfam links 1 more: Q6A6D0, E6D6I8, E4HN45
>3 PIRSF links 1 more: Q6A6D0, E6D6I8, E4HN45
>3 SUPERFAM links 1 more: Q6A6D0, E6D6I8, E4HN45
Sequence
Graphical view for this peptide sequence: proac-q6a6d0
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MRWLNDPLLDGFEYARIGLPHAAKAVGDPDGLLTASVVRRGEPRHGRAML
YVHGWSDCFYQAHLAEVVESWGYDFLGLDLRRYGRNLVPGQMAGWVRDLA
EYDEEIDAAVSLLRADHDSVTIMGHSTGGLIVPLWVSRHPGWVDGVILNS
PWIDLQGSFLTRALAGPVARSVRVAEPTTVLPIPSRDNFGHSIRREFGGE
WDVPEVKDPSWAPFVTRAGWLAAILDGHQKVAQGLHIDVPLLVLISARSD
LSATWKPSMKTADTVLDVDRLARAAVNLGRHLTLVRVRGGLHDVVLSAPS
VRAGVFAEMERWVDAYLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRWLNDPLLDGFEYARIGLPHAAKAVGDPDGLLTASVVRRGEPRHGRAML
YVHGWSDCFYQAHLAEVVESWGYDFLGLDLRRYGRNLVPGQMAGWVRDLA
EYDEEIDAAVSLLRADHDSVTIMGHSTGGLIVPLWVSRHPGWVDGVILNS
PWIDLQGSFLTRALAGPVARSVRVAEPTTVLPIPSRDNFGHSIRREFGGE
WDVPEVKDPSWAPFVTRAGWLAAILDGHQKVAQGLHIDVPLLVLISARSD
LSATWKPSMKTADTVLDVDRLARAAVNLGRHLTLVRVRGGLHDVVLSAPS
VRAGVFAEMERWVDAYLA


Reference
    Title: The complete genome sequence of Propionibacterium acnes, a commensal of human skin
    Bruggemann H, Henne A, Hoster F, Liesegang H, Wiezer A, Strittmatter A, Hujer S, Durre P, Gottschalk G
    Ref: Science, 305:671, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer