Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: proac-q6a981

Propionibacterium acnes proline iminopeptidase (EC 3.4.11.5)

Comment
Other strains: Propionibacterium acnes (HL005PA2; HL072PA1; HL063PA2; HL110PA4; HL083PA2; HL096PA3; HL045PA1; HL096PA2; HL036PA2; HL005PA4; HL110PA2; HL036PA3; HL002PA2; J139; HL005PA1; HL030PA2; HL030PA1; HL110PA3; HL082PA2; HL027PA1; HL050PA3; HL059PA1; HL083PA1; HL082PA1; HL050PA1; HL086PA1; HL067PA1; HL002PA1; HL078PA1; HL046PA1; HL025PA1; HL027PA2; HL092PA1; HL046PA2; HL007PA1; HL110PA1; HL103PA1; HL013PA1; HL056PA1; HL097PA1; HL053PA1; HL074PA1; HL037PA1; HL038PA1; HL060PA1; HL001PA1; HL013PA2; HL087PA2; HL059PA2; HL005PA3; SK187; HL043PA1; HL072PA2; HL043PA2; HL050PA2; HL053PA2; HL087PA3; HL002PA3; HL063PA1; HL036PA1; J165; SK137; HL099PA1; HL087PA1; HL020PA1; HL025PA2; SK182; SK182B-JCVI; 266; TypeIA2 (P.acn33; P.acn17; P.acn31); PRP-38; C1; HL096PA1; JCM 18909; JCM 18916; JCM 18918; P6; PA2; HL042PA3; ATCC 11828; 6609; JCM 18920) Propionibacterium sp. (5_U_42AFAA; KPL2009; KPL2003; KPL1854; KPL1849; KPL1847; KPL2008; CC003-HC2; 434-HC2; 409-HC1)


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Propionibacterium acnes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Cutibacterium: N E > Cutibacterium acnes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: proac-q6a981
Colored MSA for Proline_iminopeptidase (raw)
MTLATSELDITPHRDLYPPIEPYDTQMVDVGDGQQLYVEQCGNPEGKPVV
FLHGGPGGGGGTERRRFFNPDAYRIIILDQRGCGLSTPHIAQAHTPREMA
TNTTWKLVEDLEKIRELLGIERWEVFGGSWGSCLSLAYAETHPERVTELV
LRGIFTMREQELDWYYNFGASEVFPELWNKFCEPLRRVGHDFSRDNIAAY
YDLLWDDDPDVHGPAAVAWTTWEGATTSLSFDRSHIEEFSDPNFALAFAR
IENHYFVNHGFMVEGQLLRDAHKLADIPTVIVQGRYDMCCPDVTAVDLSR
ALPSADLRIVMAGHSAFEPLIASELVKVCDEFAER
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTLATSELDITPHRDLYPPIEPYDTQMVDVGDGQQLYVEQCGNPEGKPVV
FLHGGPGGGGGTERRRFFNPDAYRIIILDQRGCGLSTPHIAQAHTPREMA
TNTTWKLVEDLEKIRELLGIERWEVFGGSWGSCLSLAYAETHPERVTELV
LRGIFTMREQELDWYYNFGASEVFPELWNKFCEPLRRVGHDFSRDNIAAY
YDLLWDDDPDVHGPAAVAWTTWEGATTSLSFDRSHIEEFSDPNFALAFAR
IENHYFVNHGFMVEGQLLRDAHKLADIPTVIVQGRYDMCCPDVTAVDLSR
ALPSADLRIVMAGHSAFEPLIASELVKVCDEFAER


References
6 more
    Title: Genome sequence of Propionibacterium acnes type II strain ATCC 11828
    Horvath B, Hunyadkurti J, Voros A, Fekete C, Urban E, Kemeny L, Nagy I
    Ref: Journal of Bacteriology, 194:202, 2012 : PubMed

            

    Title: Complete genome sequence of Propionibacterium acnes type IB strain 6609
    Hunyadkurti J, Feltoti Z, Horvath B, Nagymihaly M, Voros A, McDowell A, Patrick S, Urban E, Nagy I
    Ref: Journal of Bacteriology, 193:4561, 2011 : PubMed

            

    Title: The complete genome sequence of Propionibacterium acnes, a commensal of human skin
    Bruggemann H, Henne A, Hoster F, Liesegang H, Wiezer A, Strittmatter A, Hujer S, Durre P, Gottschalk G
    Ref: Science, 305:671, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer