Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: profr-b3cky5

Propionibacterium freudenreichii subsp. shermanii Carboxylic ester hydrolase

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Propionibacterium freudenreichii subsp. shermanii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Propionibacterium: N E > Propionibacterium freudenreichii: N E > Propionibacterium freudenreichii subsp. shermanii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AM944371
1 UniProt : B3CKY5
1 UniProt : B3CKY5
1 Interpro : B3CKY5
1 Pfam : B3CKY5
1 PIRSF : B3CKY5
1 SUPERFAM : B3CKY5
Sequence
Graphical view for this peptide sequence: profr-b3cky5
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MRRRTTIAALAAVLSFSPLAAQAAPASADGGTSSTPRSVATSTSSAGVDP
ASACGDLVQLAPVLGSDHTPDGKQITPKPTADGRRVPVIIVHGWVSYDTH
SDARDHLFSQYVDRTADPAGGTGYLLAQSQYRSSLIGMLQQVPGAEVYTF
DYSQVGSRWVTDPQIGPKLSQAIECLSDSYQQKPVLVTHSMGGLVARQAL
SNNDSKGRPISGRVSNVLAVGAPNNGSDSAQMIASALTIGSEIPLAGLPI
RMLWDYIGQCSEQMDATNTTCTGIRAVDAFRSSGGEALRTGSAQLAQLPW
WPDNVKVTAYVGDIQMGGISLFGLNSPRLLDLGDLLVSVDSAKAGSQRSR
QVNCEYGIISTKSAETGLVRLMLAGQGNSVEQPADLLSSPCFHEAMLHET
TITGDLQRDLTEVLGANTAWHDPATAGEQSAGATTVSAVRESR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRRRTTIAALAAVLSFSPLAAQAAPASADGGTSSTPRSVATSTSSAGVDP
ASACGDLVQLAPVLGSDHTPDGKQITPKPTADGRRVPVIIVHGWVSYDTH
SDARDHLFSQYVDRTADPAGGTGYLLAQSQYRSSLIGMLQQVPGAEVYTF
DYSQVGSRWVTDPQIGPKLSQAIECLSDSYQQKPVLVTHSMGGLVARQAL
SNNDSKGRPISGRVSNVLAVGAPNNGSDSAQMIASALTIGSEIPLAGLPI
RMLWDYIGQCSEQMDATNTTCTGIRAVDAFRSSGGEALRTGSAQLAQLPW
WPDNVKVTAYVGDIQMGGISLFGLNSPRLLDLGDLLVSVDSAKAGSQRSR
QVNCEYGIISTKSAETGLVRLMLAGQGNSVEQPADLLSSPCFHEAMLHET
TITGDLQRDLTEVLGANTAWHDPATAGEQSAGATTVSAVRESR


Reference
    Title: A genomic search approach to identify esterases in Propionibacterium freudenreichii involved in the formation of flavour in Emmental cheese
    Dherbecourt J, Falentin H, Canaan S, Thierry A
    Ref: Microb Cell Fact, 7:16, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer