Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psea2-s6bc01

Pseudozyma antarctica (Yeast) (Candida antarctica) Moesziomyces antarcticus Cutinase-like enzyme

Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Pseudozyma antarctica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Ustilaginomycotina: N E > Ustilaginomycetes: N E > Ustilaginales: N E > Ustilaginaceae: N E > Moesziomyces: N E > Moesziomyces antarcticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 7CC4, 7CW1
No kinetic





No Substrate
No inhibitor
1 UniProt : S6BC01
2 Structure : 7CW1, 7CC4
1 UniProt : S6BC01
1 Interpro : S6BC01
1 Prodom : S6BC01
1 Pfam : S6BC01
1 PIRSF : S6BC01
1 SUPERFAM : S6BC01
Sequence
Graphical view for this peptide sequence: psea2-s6bc01
Colored MSA for Cutinase (raw)
MQFKSTFAALVLAAAGLVQAAPLQERAGCSSYVIINTRGTSEPQGPSVGF
RTMNTRIRSAVSGGSEYDTVYPAGIDQNSAQGTANIVAQVKAGLARNPNT
CFLLEGYSQGAAATCNALPQLTGAAFDAVKGVILIGNPEHKPNLACNVDG
NGGKTTFSARGISAAFTQGVPSNWVSKTLDICIYGDGVCDVSSGFGITPQ
HLTYGYNTNVQTMGANFGIKALQG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQFKSTFAALVLAAAGLVQAAPLQERAGCSSYVIINTRGTSEPQGPSVGF
RTMNTRIRSAVSGGSEYDTVYPAGIDQNSAQGTANIVAQVKAGLARNPNT
CFLLEGYSQGAAATCNALPQLTGAAFDAVKGVILIGNPEHKPNLACNVDG
NGGKTTFSARGISAAFTQGVPSNWVSKTLDICIYGDGVCDVSSGFGITPQ
HLTYGYNTNVQTMGANFGIKALQG


References
    Title: Construction of a Pseudozyma antarctica strain without foreign DNA sequences (self-cloning strain) for high yield production of a biodegradable plastic-degrading enzyme
    Sameshima-Yamashita Y, Watanabe T, Tanaka T, Tsuboi S, Yarimizu T, Morita T, Koike H, Suzuki K, Kitamoto H
    Ref: Biosci Biotechnol Biochem, :1, 2019 : PubMed

            

    Title: Production of a biodegradable plastic-degrading enzyme from cheese whey by the phyllosphere yeast Pseudozyma antarctica GB-4(1)W
    Watanabe T, Shinozaki Y, Suzuki K, Koitabashi M, Yoshida S, Sameshima-Yamashita Y, Kuze Kitamoto H
    Ref: J Biosci Bioeng, 118:183, 2014 : PubMed

            

    Title: Xylose induces the phyllosphere yeast Pseudozyma antarctica to produce a cutinase-like enzyme which efficiently degrades biodegradable plastics
    Watanabe T, Shinozaki Y, Yoshida S, Koitabashi M, Sameshima-Yamashita Y, Fujii T, Fukuoka T, Kitamoto HK
    Ref: J Biosci Bioeng, 117:325, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer