Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseae-PA2086

Pseudomonas aeruginosa (strains PA01; C3719; LESB58; 2192; UCBPP-PA14) PA2086

Relationship
Family|Haloacetate_dehalogenase
Block| X
Position in NCBI Life Tree|Pseudomonas aeruginosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas aeruginosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
6 structures (e.g. : 4B9A, 4B9E, 4BAT... more)
No kinetic





1 substrate:
Fluoroacetate
No inhibitor
>3 Genbank links 2 more: AE004636, CH482383, FM209186
1 Ncbi-nid : 9948093
1 Ncbi-pid : 9948098
>3 Structure links 3 more: 4BAZ, 4BB0, 4BAT
1 UniProt : Q9I229
1 Interpro : Q9I229
1 Pfam : Q9I229
1 PIRSF : Q9I229
1 SUPERFAM : Q9I229
Sequence
Graphical view for this peptide sequence: pseae-PA2086
Colored MSA for Haloacetate_dehalogenase (raw)
MNTDPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIA
PRLAEDYSVVLADLRGYGESRALDEEGADYSKAALARDQLETMGQLGFER
FAVIGHDRGARVGYRLALDHPQAVAAFVSLTVVPILDNWAAVNKVFALNA
YHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRA
FRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWQERPYAA
GQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREALR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNTDPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIA
PRLAEDYSVVLADLRGYGESRALDEEGADYSKAALARDQLETMGQLGFER
FAVIGHDRGARVGYRLALDHPQAVAAFVSLTVVPILDNWAAVNKVFALNA
YHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRA
FRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWQERPYAA
GQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREALR


References
2 more
    Title: Newly introduced genomic prophage islands are critical determinants of in vivo competitiveness in the Liverpool Epidemic Strain of Pseudomonas aeruginosa
    Winstanley C, Langille MG, Fothergill JL, Kukavica-Ibrulj I, Paradis-Bleau C, Sanschagrin F, Thomson NR, Winsor GL, Quail MA and Levesque RC <9 more author(s)>
    Ref: Genome Res, 19:12, 2009 : PubMed

            

    Title: Dynamics of Pseudomonas aeruginosa genome evolution
    Mathee K, Narasimhan G, Valdes C, Qiu X, Matewish JM, Koehrsen M, Rokas A, Yandava CN, Engels R and Lory S <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 105:3100, 2008 : PubMed

            

    Title: Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen
    Stover CK, Pham XQ, Erwin AL, Mizoguchi SD, Warrener P, Hickey MJ, Brinkman FS, Hufnagle WO, Kowalik DJ and Olson MV <21 more author(s)>
    Ref: Nature, 406:959, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer