Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseae-q9hyv3

Pseudomonas aeruginosa; Pseudomonas fluorescens; Pseudomonas sp. the type VI secretion phospholipase effector Tle1 protein

Comment
only n-term Pfam A DUF2235 61 158 Pfam A DUF2235 259 412. Other strains: Pseudomonas aeruginosa (strains: ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228); UCBPP-PA14); Pseudomonas fluorescens; Pseudomonas sp. FDAARGOS_761


Relationship
Family|Duf_2235
Block| X
Position in NCBI Life Tree|Pseudomonas aeruginosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas aeruginosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
4O5P: Crystal structure of the type VI secretion phospholipase effector Tle1 protein from Pseudomonas aeruginosa
No kinetic





No Substrate
No inhibitor
>3 Genbank links 31 more: AAG06678, NP_251980, WP_010895654
>3 UniProt links 10 more: Q9HYV3, A0A5E9KFR7, A0A2C9WY50
1 Structure : 4O5P
>3 UniProt links 10 more: Q9HYV3, A0A5E9KFR7, A0A2C9WY50
>3 Interpro links 10 more: Q9HYV3, A0A5E9KFR7, A0A2C9WY50
>3 Prodom links 10 more: Q9HYV3, A0A5E9KFR7, A0A2C9WY50
>3 Pfam links 10 more: Q9HYV3, A0A5E9KFR7, A0A2C9WY50
>3 PIRSF links 10 more: Q9HYV3, A0A5E9KFR7, A0A2C9WY50
>3 SUPERFAM links 10 more: Q9HYV3, A0A5E9KFR7, A0A2C9WY50
Sequence
Graphical view for this peptide sequence: pseae-q9hyv3
Colored MSA for Duf_2235 (raw)
MPNFGFHIAPTHPVAGRLTYDSKKLSENILKQQSDERVFSRAQEQKRLSE
GDVVGGAPCCKAIHITLGFDGTNNNDKADGSSVSPSCSNVARLIHASIGS
GDDINSRGIFKYYCPGVGTVFPDIKEFTPSNMGLIGAEGGENRINWGLVQ
LVDALFYTLLKSRLKLNDVQGLVEEMSTNWTVSTLTGGLLENGEKKRRAA
LEPKLKELEEKLRQRQNSGQKPHILAMRLYIYGFSRGAAEARAFANWLQE
LTRVSDADGRVEYRFAGLPISIEFLGLFDTVAAVGLADSAPFAAGHMDWA
DDTMRLPDEALSQCLPTILPEDCSFLKRCVHLVSCHEQRASFPLDSIRRR
DMDANGRRTGPSCYRKWTVEYAYPGVHSDVGGGYGVGNQGKAVGGSEFLL
SQIALQHMYAEAFEAGAPLQVPAPAVHPDFHEEWRVMVPKIEAEFSVSEE
LATRFNAWQAQAK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPNFGFHIAPTHPVAGRLTYDSKKLSENILKQQSDERVFSRAQEQKRLSE
GDVVGGAPCCKAIHITLGFDGTNNNDKADGSSVSPSCSNVARLIHASIGS
GDDINSRGIFKYYCPGVGTVFPDIKEFTPSNMGLIGAEGGENRINWGLVQ
LVDALFYTLLKSRLKLNDVQGLVEEMSTNWTVSTLTGGLLENGEKKRRAA
LEPKLKELEEKLRQRQNSGQKPHILAMRLYIYGFSRGAAEARAFANWLQE
LTRVSDADGRVEYRFAGLPISIEFLGLFDTVAAVGLADSAPFAAGHMDWA
DDTMRLPDEALSQCLPTILPEDCSFLKRCVHLVSCHEQRASFPLDSIRRR
DMDANGRRTGPSCYRKWTVEYAYPGVHSDVGGGYGVGNQGKAVGGSEFLL
SQIALQHMYAEAFEAGAPLQVPAPAVHPDFHEEWRVMVPKIEAEFSVSEE
LATRFNAWQAQAK


References
    Title: Structure of the type VI secretion phospholipase effector Tle1 provides insight into its hydrolysis and membrane targeting
    Hu H, Zhang H, Gao Z, Wang D, Liu G, Xu J, Lan K, Dong Y
    Ref: Acta Crystallographica D Biol Crystallogr, 70:2175, 2014 : PubMed

            

    Title: Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen
    Stover CK, Pham XQ, Erwin AL, Mizoguchi SD, Warrener P, Hickey MJ, Brinkman FS, Hufnagle WO, Kowalik DJ and Olson MV <21 more author(s)>
    Ref: Nature, 406:959, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer