Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psef5-q4kh30

Pseudomonas fluorescens; Pseudomonas protegens, 3-oxoadipate enol-lactonase (EC 3.1.1.24)

Comment
Other strains: Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477); Pseudomonas protegens (Cab57; DSM 19095 / CHA0)


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Pseudomonas fluorescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas fluorescens group: N E > Pseudomonas fluorescens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP000076, AP014522, CP003190
1 UniProt : Q4KH30
1 UniProt : Q4KH30
1 Interpro : Q4KH30
1 Prodom : Q4KH30
1 Pfam : Q4KH30
1 PIRSF : Q4KH30
1 SUPERFAM : Q4KH30
Sequence
Graphical view for this peptide sequence: psef5-q4kh30
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MKLAEGELHYQLEGPEGAPVLVLSNSLGTDLHMWDKQMAAFTRHFQVLRM
DTRGHGRSLVTEGPYSIEQLGRDVVALLDALDIQRAHFCGLSMGGLIGQW
LGINAGERLHKLVVCNTAAKIGDPSVWNPRIETVLRDGQAAMVALRDASI
ARWFTSDFAEAHPDQAKLITDMLAATSPQGYAANCAAVRDADFREQLGAI
KVPTLVIAGTEDAVTPPSGGHFIQQHVAGAEYAEFYAAHLSNVQAGDAFS
ARVVDFLLV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLAEGELHYQLEGPEGAPVLVLSNSLGTDLHMWDKQMAAFTRHFQVLRM
DTRGHGRSLVTEGPYSIEQLGRDVVALLDALDIQRAHFCGLSMGGLIGQW
LGINAGERLHKLVVCNTAAKIGDPSVWNPRIETVLRDGQAAMVALRDASI
ARWFTSDFAEAHPDQAKLITDMLAATSPQGYAANCAAVRDADFREQLGAI
KVPTLVIAGTEDAVTPPSGGHFIQQHVAGAEYAEFYAAHLSNVQAGDAFS
ARVVDFLLV


References
    Title: Complete genome sequence of the biocontrol strain Pseudomonas protegens Cab57 discovered in Japan reveals strain-specific diversity of this species
    Takeuchi K, Noda N, Someya N
    Ref: PLoS ONE, 9:e93683, 2014 : PubMed

            

    Title: Complete genome sequence of the plant commensal Pseudomonas fluorescens Pf-5
    Paulsen IT, Press CM, Ravel J, Kobayashi DY, Myers GS, Mavrodi DV, DeBoy RT, Seshadri R, Ren Q and Loper JE <19 more author(s)>
    Ref: Nat Biotechnol, 23:873, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer