Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psefl-cumD

Pseudomonas fluorescens cumD 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase

Comment
Q7BJY2 AF285864 Pseudomonas sp. JR1 homoda hydrolase ipbd


Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Pseudomonas fluorescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas fluorescens group: N E > Pseudomonas fluorescens: N E


Molecular evidence
Database
No mutation
10 structures (e.g. : 1IUN, 1IUO, 1IUP... more)
No kinetic





1 substrate:
n-valerate
1 inhbitor:
Benzoic-acid
3 Genbank : D83955, BAA12150, AF285864
1 Ncbi-nid : 1871459
1 Ncbi-pid : 1871461
>3 Structure links 7 more: 2D0D, 1IUN, 1IUO
2 UniProt : P96965, Q7BJY2
2 Interpro : P96965, Q7BJY2
2 Prodom : P96965, Q7BJY2
2 Pfam : P96965, Q7BJY2
2 PIRSF : P96965, Q7BJY2
2 SUPERFAM : P96965, Q7BJY2
Sequence
Graphical view for this peptide sequence: psefl-cumD
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MANLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPA
LSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIV
GNSFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIE
NMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWID
ALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRC
GHWTQIEQTDRFNRLVVEFFNEANTPKLVGRP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPA
LSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIV
GNSFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIE
NMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWID
ALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRC
GHWTQIEQTDRFNRLVVEFFNEANTPKLVGRP


References
1 more
    Title: A series of crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with various cleavage products
    Fushinobu S, Jun SY, Hidaka M, Nojiri H, Yamane H, Shoun H, Omori T, Wakagi T
    Ref: Biosci Biotechnol Biochem, 69:491, 2005 : PubMed

            

    Title: Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
    Fushinobu S, Saku T, Hidaka M, Jun SY, Nojiri H, Yamane H, Shoun H, Omori T, Wakagi T
    Ref: Protein Science, 11:2184, 2002 : PubMed

            

    Title: Analysis of cumene (isopropylbenzene) degradation genes from Pseudomonas fluorescens IP01
    Habe H, Kasuga K, Nojiri H, Yamane H, Omori T
    Ref: Applied Environmental Microbiology, 62:4471, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer