Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psefl-cxest

Pseudomonas fluorescens carboxylesterase

Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Pseudomonas fluorescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas fluorescens group: N E > Pseudomonas fluorescens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 1AUO, 1AUR
No kinetic





No Substrate
1 inhbitor:
PMSF
1 Genbank : S79600
1 UniProt : Q53547
1 Ncbi-nid : 244500
1 Ncbi-pid : 244501
2 Structure : 1AUR, 1AUO
1 UniProt : Q53547
1 Interpro : Q53547
1 Prodom : Q53547
1 Pfam : Q53547
1 PIRSF : Q53547
1 SUPERFAM : Q53547
Sequence
Graphical view for this peptide sequence: psefl-cxest
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MTEPLILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQ
APTRPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKR
TGIDASRIFLAGFSQGGAVVFHTAFINWQGPLGGVIALSTYAPTFGDELE
LSASQQRIPALCLHGQYDDVVQNAMGRSAFEHLKSRGVTVTWQEYPMGHE
VLPQEIHDIGAWLAARLG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTEPLILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQ
APTRPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKR
TGIDASRIFLAGFSQGGAVVFHTAFINWQGPLGGVIALSTYAPTFGDELE
LSASQQRIPALCLHGQYDDVVQNAMGRSAFEHLKSRGVTVTWQEYPMGHE
VLPQEIHDIGAWLAARLG


References
    Title: Crystal structure of carboxylesterase from Pseudomonas fluorescens, an alpha/beta hydrolase with broad substrate specificity
    Kim KK, Song HK, Shin DH, Hwang KY, Choe S, Yoo OJ, Suh SW
    Ref: Structure, 5:1571, 1997 : PubMed

            

    Title: Characterization of Pseudomonas fluorescens carboxylesterase: cloning and expression of the esterase gene in Escherichia coli
    Hong KH, Jang WH, Choi KD, Yoo OJ
    Ref: Agric and Biological Chemistry, 55:2839, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer