psemy-a4y035

 
Pseudomonas mendocina lipase PmCut PCLase I

Comment
the sequence is the structure one and not the a4y035. Other strains: Pseudomonas mendocina (strain ymp); Pseudomonas hydrolytica sp. DSWY01T


Relationship
Block L
Pseudomonas mendocina position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas mendocina: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
2FX5: Pseudomonas mendocina lipase
No kinetic

Substrate: Polycaprolactone ,

>3 Genbank links 2 more: 112490644, NC_009439, YP_001189683
1 UniProt : A4Y035
1 Ncbi-nid : 146309218
1 Ncbi-pid : 5106628
1 Structure : 2FX5
1 UniProtTrembl : A4Y035
1 Interpro : A4Y035
1 Prodom : A4Y035
1 Pfam : A4Y035
1 PIRSF : A4Y035
1 SUPERFAM : A4Y035
1 QuickSwissBlast : A4Y035
 
Sequence
Graphical view for this peptide sequence: psemy-a4y035
Colored MSA for Polyesterase-lipase-cutinase (raw)
APLPDTPGAPFPAVANFDRSGPYTVSSQSEGPSCRIYRPRDLGQGGVRHP
VILWGNGTGAGPSTYAGLLSHWASHGFVVAAAETSNAGTGREMLACLDYL
VRENDTPYGTYSGKLNTGRVGTSGHSQGGGGSIMAGQDTRVRTTAPIQPY
TLGLGHDSASQRRQQGPMFLMSGGGDTIAFPYLNAQPVYRRANVPVFWGE
RRYVSHFEPVGSGGAYRGPSTAWFRFQLMDDQDARATFYGAQCSLCTSLL
WSVERRGL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

APLPDTPGAPFPAVANFDRSGPYTVSSQSEGPSCRIYRPRDLGQGGVRHP
VILWGNGTGAGPSTYAGLLSHWASHGFVVAAAETSNAGTGREMLACLDYL
VRENDTPYGTYSGKLNTGRVGTSGHSQGGGGSIMAGQDTRVRTTAPIQPY
TLGLGHDSASQRRQQGPMFLMSGGGDTIAFPYLNAQPVYRRANVPVFWGE
RRYVSHFEPVGSGGAYRGPSTAWFRFQLMDDQDARATFYGAQCSLCTSLL
WSVERRGL

no DNA




References
2 more
    Title: Perspectives on the Role of Enzymatic Biocatalysis for the Degradation of Plastic PET
    Magalhaes RP, Cunha JM, Sousa SF
    Ref: Int J Mol Sci, 22:11257, 2021 : PubMed

            

    Title: Comparative NMR study on the impact of point mutations on protein stability of Pseudomonas mendocina lipase
    Sibille N, Favier A, Azuaga AI, Ganshaw G, Bott R, Bonvin AM, Boelens R, van Nuland NA
    Ref: Protein Science, 15:1915, 2006 : PubMed

            

    Title: Structure and function engineered Pseudomonas mendocina lipase
    Boston M, Requadt C, Danko S, Jarnagin A, Ashizawa E, Wu S, Poulose AJ, Bott R
    Ref: Methods Enzymol, 284:298, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer