Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psepu-PIP

Pseudomonas putida proline iminopeptidase

Comment
Other strains: Pseudomonas putida (strains KT2440; F1 / ATCC 700007; GB-1; W619; BIRD-1; TJI-51; S16; ND6; DOT-T1E; GM84; HB3267; CSV86; LS46; TRO1; H8234; NBRC 14164; LF54; SJ3; S12; S610); Pseudomonas entomophila (strain L48); Pseudomonas plecoglossicida NB2011; Pseudomonas sp. (VLB120; FGI182); Pseudomonas monteilii (SB3078; SB3101)


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Pseudomonas putida
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas putida group: N E > Pseudomonas putida: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 23 more: AE016792, CP000712, CP000926
>3 UniProt links 10 more: A5WA62, B0KM53, B1J2R1
>3 UniProt links 11 more: Q88D01, A5WA62, B0KM53
>3 Interpro links 11 more: Q88D01, A5WA62, B0KM53
>3 Prodom links 11 more: Q88D01, A5WA62, B0KM53
>3 Pfam links 11 more: Q88D01, A5WA62, B0KM53
>3 PIRSF links 11 more: Q88D01, A5WA62, B0KM53
>3 SUPERFAM links 11 more: Q88D01, A5WA62, B0KM53
Sequence
Graphical view for this peptide sequence: psepu-PIP
Colored MSA for Proline_iminopeptidase (raw)
MQTLYPQIKPYARHDLAVEAPHVLYVDESGSPEGLPVVFIHGGPGAGCDA
QSRCYFDPNLYRIITFDQRGCGRSTPHASLENNTTWHLVEDLERIREHLG
IDKWVLFGGSWGSTLALAYAQAHPERVHGLILRGIFLCRPQEIEWFYQEG
ASRLFPDYWQDYIAPIPPEERGDLVRAFHKRLTGNDQIAQMHAAKAWSTW
EGRTATLRPNPLVVDRFSEPQRALSIARIECHYFMNNAFLEPDQLIRDLP
KIAHLPAVIVHGRYDVICPLDNAWALHQAWPNSELKVIRDAGHAASEPGI
TDALVRAADQMARRLLDLPLEEA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQTLYPQIKPYARHDLAVEAPHVLYVDESGSPEGLPVVFIHGGPGAGCDA
QSRCYFDPNLYRIITFDQRGCGRSTPHASLENNTTWHLVEDLERIREHLG
IDKWVLFGGSWGSTLALAYAQAHPERVHGLILRGIFLCRPQEIEWFYQEG
ASRLFPDYWQDYIAPIPPEERGDLVRAFHKRLTGNDQIAQMHAAKAWSTW
EGRTATLRPNPLVVDRFSEPQRALSIARIECHYFMNNAFLEPDQLIRDLP
KIAHLPAVIVHGRYDVICPLDNAWALHQAWPNSELKVIRDAGHAASEPGI
TDALVRAADQMARRLLDLPLEEA


References
13 more
    Title: Complete genome of the plant growth-promoting rhizobacterium Pseudomonas putida BIRD-1
    Matilla MA, Pizarro-Tobias P, Roca A, Fernandez M, Duque E, Molina L, Wu X, van der Lelie D, Gomez MJ and Ramos JL <1 more author(s)>
    Ref: Journal of Bacteriology, 193:1290, 2011 : PubMed

            

    Title: Complete genome sequence of the nicotine-degrading Pseudomonas putida strain S16
    Yu H, Tang H, Wang L, Yao Y, Wu G, Xu P
    Ref: Journal of Bacteriology, 193:5541, 2011 : PubMed

            

    Title: Complete genome sequence and comparative analysis of the metabolically versatile Pseudomonas putida KT2440
    Nelson KE, Weinel C, Paulsen IT, Dodson RJ, Hilbert H, Martins dos Santos VA, Fouts DE, Gill SR, Pop M and Fraser CM <33 more author(s)>
    Ref: Environ Microbiol, 4:799, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer