Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psepu-i7b6a1

Pseudomonas putida DOT-T1E PnbA

Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Pseudomonas putida DOT-T1E
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas putida group: N E > Pseudomonas putida: N E > Pseudomonas putida DOT-T1E: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP003734
1 UniProt : I7B6A1
1 UniProt : I7B6A1
1 Interpro : I7B6A1
1 Prodom : I7B6A1
1 Pfam : I7B6A1
1 PIRSF : I7B6A1
1 SUPERFAM : I7B6A1
Sequence
Graphical view for this peptide sequence: psepu-i7b6a1
Colored MSA for Carb_B_Bacteria (raw)
MCSKSTQSAVVQTEQGAIRGTFDIAAGLHTFFGIPYAKAPVGALRFRPPQ
PYEGWSGVRDASRFGSASAQLFDSTEGEFSEFTDEPQVEGQPWVGSEDCL
TLNVWTPAVAPHKKPVVIWIHGGANWLESSRLEGYHGDQLAKNGDLVFVS
INYRLGVFGFLDVSVLGGTEYSGSHSHGLLDQLQAVRWVCSNIAQFGGDP
ENITLMGESAGSIDISWHLAGGHLNGLVRRVVMMSGYAGLPGLSGDLTYG
LSDASAGDVAREFFADCGIDSFQQLNEMTTADLMMKVHQLSESRDMLFHM
DSLFWPKSHAKSSLVDPIAFAAKGEATGIDIIIGFTNYEMGLWLNWDEQI
DQLGMDSVIENIGIPARLAESVKNLYCETFPDENDGQRAMHLLGDSAFVM
PSLWAAEGLARNNRVKVYRFDRETDPRRRAQHAADQVYFFDKLDTYVGKR
LAGLPANSTDSKERESLVRLMQGLIFNYAETSQPDYPAWADYDTENRPLL
ALDADPSIKSDPYGKRREWWFQNIYPRP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCSKSTQSAVVQTEQGAIRGTFDIAAGLHTFFGIPYAKAPVGALRFRPPQ
PYEGWSGVRDASRFGSASAQLFDSTEGEFSEFTDEPQVEGQPWVGSEDCL
TLNVWTPAVAPHKKPVVIWIHGGANWLESSRLEGYHGDQLAKNGDLVFVS
INYRLGVFGFLDVSVLGGTEYSGSHSHGLLDQLQAVRWVCSNIAQFGGDP
ENITLMGESAGSIDISWHLAGGHLNGLVRRVVMMSGYAGLPGLSGDLTYG
LSDASAGDVAREFFADCGIDSFQQLNEMTTADLMMKVHQLSESRDMLFHM
DSLFWPKSHAKSSLVDPIAFAAKGEATGIDIIIGFTNYEMGLWLNWDEQI
DQLGMDSVIENIGIPARLAESVKNLYCETFPDENDGQRAMHLLGDSAFVM
PSLWAAEGLARNNRVKVYRFDRETDPRRRAQHAADQVYFFDKLDTYVGKR
LAGLPANSTDSKERESLVRLMQGLIFNYAETSQPDYPAWADYDTENRPLL
ALDADPSIKSDPYGKRREWWFQNIYPRP



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer