Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psepu-q9wwz4

Pseudomonas putida (Arthrobacter siderocapsulatus); Pseudomonas monteilii ; Pseudomonas sp.; Pseudomonas taiwanensis; Pseudomonas plecoglossicida, PcaD-like protein

Comment
Other strains: Pseudomonas putida (LS46; S16; F1 / ATCC 700007; BIRD-1; KT2440; TRO1; HB3267; LF54; GB-1; S12; ND6; H8234; NBRC 14164; DOT-T1E; Pseudomonas monteilii (SB3101; SB3078); Pseudomonas sp. (TJI-51; WCS358; FGI182; H2); Pseudomonas taiwanensis SJ9; Pseudomonas plecoglossicida


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Pseudomonas putida
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas putida group: N E > Pseudomonas putida: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 25 more: AF031417, JOJY01000001, ALPV02000013
>3 UniProt links 12 more: Q9WWZ4, A0A099N5T5, F8G4B5
>3 UniProt links 11 more: Q9WWZ4, A0A099N5T5, F8G4B5
>3 Interpro links 11 more: Q9WWZ4, A0A099N5T5, F8G4B5
>3 Prodom links 11 more: Q9WWZ4, A0A099N5T5, F8G4B5
>3 Pfam links 11 more: Q9WWZ4, A0A099N5T5, F8G4B5
>3 PIRSF links 11 more: Q9WWZ4, A0A099N5T5, F8G4B5
>3 SUPERFAM links 11 more: Q9WWZ4, A0A099N5T5, F8G4B5
Sequence
Graphical view for this peptide sequence: psepu-q9wwz4
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MAHLQLADGVLNYQIDGPDDAPVLVLSNSLGTDLGMWDTQIPLWSQHFRV
LRYDTRGHGASLVTEGPYSIEQLGRDVLALLDGLDIQKAHFVGLSMGGLI
GQWLGIHAGERLHSLTLCNTAAKIANDEVWNTRIDTVLKGGQQAMVDLRD
ASIARWFTPGFAQAQAEQAQRICQMLAQTSPQGYAGNCAAVRDADYREQL
GRIQVPALIVAGTEDVVTTPEHGRFMQAGIQGAEYVDFPAAHLSNVDIGE
AFSRRVLDFLLAH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAHLQLADGVLNYQIDGPDDAPVLVLSNSLGTDLGMWDTQIPLWSQHFRV
LRYDTRGHGASLVTEGPYSIEQLGRDVLALLDGLDIQKAHFVGLSMGGLI
GQWLGIHAGERLHSLTLCNTAAKIANDEVWNTRIDTVLKGGQQAMVDLRD
ASIARWFTPGFAQAQAEQAQRICQMLAQTSPQGYAGNCAAVRDADYREQL
GRIQVPALIVAGTEDVVTTPEHGRFMQAGIQGAEYVDFPAAHLSNVDIGE
AFSRRVLDFLLAH


References
11 more
    Title: Draft Genome Sequence of Medium-Chain-Length Polyhydroxyalkanoate-Producing Pseudomonas putida Strain LS46
    Sharma PK, Fu J, Zhang X, Fristensky BW, Davenport K, Chain PS, Sparling R, Levin DB
    Ref: Genome Announc, 1:e0015113, 2013 : PubMed

            

    Title: Kinetics of medium-chain-length polyhydroxyalkanoate production by a novel isolate of Pseudomonas putida LS46
    Sharma PK, Fu J, Cicek N, Sparling R, Levin DB
    Ref: Can J Microbiol, 58:982, 2012 : PubMed

            

    Title: Efflux pumps involved in toluene tolerance in Pseudomonas putida DOT-T1E
    Ramos JL, Duque E, Godoy P, Segura A
    Ref: Journal of Bacteriology, 180:3323, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer