Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesp-PHBDP1

Pseudomonas sp., Pseudomonas mendocina, Pseudomonas stutzeri (Pseudomonas perfectomarina), phb depolymerase

Comment
Other strains: Pseudomonas sp. GM101, Pseudomonas mendocina (strain ymp), Pseudomonas stutzeri (Pseudomonas perfectomarina) only n-term Pfam A Esterase_phd 57 276


Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Pseudomonas sp. GM101
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas sp. GM101: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF293347, AB012225
>3 UniProt links 2 more: Q9FD23, A4Y0J3, B5B2X9
>3 UniProt links 2 more: Q9FD23, A4Y0J3, B5B2X9
>3 Interpro links 2 more: Q9FD23, A4Y0J3, B5B2X9
>3 Prodom links 2 more: Q9FD23, A4Y0J3, B5B2X9
>3 Pfam links 2 more: Q9FD23, A4Y0J3, B5B2X9
>3 PIRSF links 2 more: Q9FD23, A4Y0J3, B5B2X9
>3 SUPERFAM links 2 more: Q9FD23, A4Y0J3, B5B2X9
Sequence
Graphical view for this peptide sequence: psesp-PHBDP1
Colored MSA for Esterase_phb (raw)
MTKQSLPQGMADQRLCRFFTAALCSLLMILLWPTTVTAGQTFSYTSPQQA
YSGSRERSYKVYVPTGLSTPAPMVMALHGCRQTNDDVLNDWGLKAAADRY
GFILVAPFITSYDGLRNENCWGFWFEQHIHQGGGEVADLHRIAQQVEANF
VIDANRRFITGLSSGGAMALVAAVAYNEYWAAAAPAAGLPYRETASSVSL
SGQCPGSATFRSVSQVAADMRSEVNDAYPIPLMILQNRNDCTVLQTAANN
MRDAHLQVFGSASRNTPATTKASDTGCSPYHQSDYGCRHIAYTQDGTTAT
RSLVETVIYDGPLATPNPQDTNHGHYWIGGAQGNNGKWSLQVGPSYPDII
WDFFSRYSRD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTKQSLPQGMADQRLCRFFTAALCSLLMILLWPTTVTAGQTFSYTSPQQA
YSGSRERSYKVYVPTGLSTPAPMVMALHGCRQTNDDVLNDWGLKAAADRY
GFILVAPFITSYDGLRNENCWGFWFEQHIHQGGGEVADLHRIAQQVEANF
VIDANRRFITGLSSGGAMALVAAVAYNEYWAAAAPAAGLPYRETASSVSL
SGQCPGSATFRSVSQVAADMRSEVNDAYPIPLMILQNRNDCTVLQTAANN
MRDAHLQVFGSASRNTPATTKASDTGCSPYHQSDYGCRHIAYTQDGTTAT
RSLVETVIYDGPLATPNPQDTNHGHYWIGGAQGNNGKWSLQVGPSYPDII
WDFFSRYSRD


Reference
    Title: Cloning and characterization of the polyhydroxybutyrate depolymerase gene of Pseudomonas stutzeri and analysis of the function of substrate-binding domains
    Ohura T, Kasuya KI, Doi Y
    Ref: Applied Environmental Microbiology, 65:189, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer