Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesp-Q9AQN6

Pseudomonas sp. CA10 CarC dienelactone hydrolase

Relationship
Family|Dienelactone_hydrolase
Block| X
Position in NCBI Life Tree|Pseudomonas sp. CA10
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas sp. CA10: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB047548
1 UniProt : Q9AQN6
1 Interpro : Q9AQN6
1 Prodom : Q9AQN6
1 Pfam : Q9AQN6
1 PIRSF : Q9AQN6
1 SUPERFAM : Q9AQN6
Sequence
Graphical view for this peptide sequence: psesp-Q9AQN6
Colored MSA for Dienelactone_hydrolase (raw)
MGKMMKVQASDGSGSFSGYLALPASGKGPGVVIGQEIFGINANMREVADL
YAEEGYVALVPDLFWRLEPGVDLGYTEADFARAIDLFQRLDIDKAVEDID
ASFKALRELPEVEASGLGYVGFCMGGKLAYLTATRTDVACAVGYYGMGIE
HLLDEAERIKGHLVLHFAEQDGYCDANARALISQRLGARPNVEIYTYPEV
DHAFARHGGMHYNKPAALMAHQRSIAALRQAIGPHYNLSALWEKHIEFEF
AVRDVPATMRPWSPSPTSTTFPP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGKMMKVQASDGSGSFSGYLALPASGKGPGVVIGQEIFGINANMREVADL
YAEEGYVALVPDLFWRLEPGVDLGYTEADFARAIDLFQRLDIDKAVEDID
ASFKALRELPEVEASGLGYVGFCMGGKLAYLTATRTDVACAVGYYGMGIE
HLLDEAERIKGHLVLHFAEQDGYCDANARALISQRLGARPNVEIYTYPEV
DHAFARHGGMHYNKPAALMAHQRSIAALRQAIGPHYNLSALWEKHIEFEF
AVRDVPATMRPWSPSPTSTTFPP


References
1 more
    Title: Genetic characterization and evolutionary implications of a car gene cluster in the carbazole degrader Pseudomonas sp. strain CA10
    Nojiri H, Sekiguchi H, Maeda K, Urata M, Nakai S, Yoshida T, Habe H, Omori T
    Ref: Journal of Bacteriology, 183:3663, 2001 : PubMed

            

    Title: Cloning of genes involved in carbazole degradation of Pseudomonas sp. strain CA10: nucleotide sequences of genes and characterization of meta-cleavage enzymes and hydrolase
    Sato SI, Ouchiyama N, Kimura T, Nojiri H, Yamane H, Omori T
    Ref: Journal of Bacteriology, 179:4841, 1997 : PubMed

            

    Title: Identification and characterization of genes encoding carbazole 1,9a-dioxygenase in Pseudomonas sp. strain CA10
    Sato SI, Nam JW, Kasuga K, Nojiri H, Yamane H, Omori T
    Ref: Journal of Bacteriology, 179:4850, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer