Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesp-Q9AQQ0

Pseudomonas sp. CA10 hypothetical 31.6 kda protein

Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Pseudomonas sp. CA10
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas sp. CA10: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB047272
1 UniProt : Q9AQQ0
1 UniProt : Q9AQQ0
1 Interpro : Q9AQQ0
1 Prodom : Q9AQQ0
1 Pfam : Q9AQQ0
1 PIRSF : Q9AQQ0
1 SUPERFAM : Q9AQQ0
Sequence
Graphical view for this peptide sequence: psesp-Q9AQQ0
Colored MSA for BD-FAE (raw)
MTRPNEPAELAAYYDVQYNARESVEDFDQYPRQYRALSDDAHARLRCIKD
VAYGPGAGERLDIFPAERPDAPVLLFIHGGYWRALSKADSAFMAPALTAA
GACVVVLDYDLAPAVTLDHIVDQTRRALAWLHRHIAEFGGDPQRLYASGS
SAGGHLTGMLLAGGWHADYGVPDNVLRGALPISGLFDLRPLLETHINGWM
GMDDAAARRNSPSFQLPTRGAELVISYGALETAEFARQSHEFLEAWTARG
LPGRFVAAPGRNHFDVVLELGQPGTPLYQAMIELMGLNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTRPNEPAELAAYYDVQYNARESVEDFDQYPRQYRALSDDAHARLRCIKD
VAYGPGAGERLDIFPAERPDAPVLLFIHGGYWRALSKADSAFMAPALTAA
GACVVVLDYDLAPAVTLDHIVDQTRRALAWLHRHIAEFGGDPQRLYASGS
SAGGHLTGMLLAGGWHADYGVPDNVLRGALPISGLFDLRPLLETHINGWM
GMDDAAARRNSPSFQLPTRGAELVISYGALETAEFARQSHEFLEAWTARG
LPGRFVAAPGRNHFDVVLELGQPGTPLYQAMIELMGLNL


Reference
    Title: Organization and transcriptional characterization of catechol degradation genes involved in carbazole degradation by Pseudomonas resinovorans strain CA10
    Nojiri H, Maeda K, Sekiguchi H, Urata M, Shintani M, Yoshida T, Habe H, Omori T
    Ref: Biosci Biotechnol Biochem, 66:897, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer