Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesy-PSPTO3135

Pseudomonas syringae (pv. tomato; T1;pv. glycinea str. B076; race 4; pv. phaseolicola (strain 1448A / Race 6) pv. syringae (strain B728a)) conserved hypothetical protein

Relationship
Family|UCP031982
Block| X
Position in NCBI Life Tree|Pseudomonas syringae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas syringae group: N E > Pseudomonas syringae group genomosp. 1: N E > Pseudomonas syringae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AE016867, ABSM01000023, AEGG01000030
2 UniProt : Q48JH9, Q4ZS36
3 UniProt : Q880L9, Q48JH9, Q4ZS36
3 Interpro : Q880L9, Q48JH9, Q4ZS36
3 Pfam : Q880L9, Q48JH9, Q4ZS36
3 PIRSF : Q880L9, Q48JH9, Q4ZS36
3 SUPERFAM : Q880L9, Q48JH9, Q4ZS36
Sequence
Graphical view for this peptide sequence: psesy-PSPTO3135
Colored MSA for UCP031982 (raw)
MLVCLLDSLISVHAQADEAWSAGYRALSFPDPLDSQPVQAIAFYPSTGSE
HLSIIHGYRVEASEDAPIAMGRFPLLLLSHGNTGTPLALHDLATSLARQG
FVVVAVVHPGDNDRDHSRLGSLSNLYGRPLQISEAISTALLDPVLAPYLN
ARQVGVIGYSAGGETALILAGAQPDLQRLRQYCLERPTDRDACKTQGELV
ADRDDLHAQADPRVGALMLMAPLSLMFGRHTLGDVHVPVLMYAGDDDQLL
ALDRNAEALARKLPQAPDYKLLAGAGHFVFMAPCSDEQREAAPLLCNDPD
GVDREDIHRNLSAEAVRFFSAALNSADADHSGMQTAHHQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLVCLLDSLISVHAQADEAWSAGYRALSFPDPLDSQPVQAIAFYPSTGSE
HLSIIHGYRVEASEDAPIAMGRFPLLLLSHGNTGTPLALHDLATSLARQG
FVVVAVVHPGDNDRDHSRLGSLSNLYGRPLQISEAISTALLDPVLAPYLN
ARQVGVIGYSAGGETALILAGAQPDLQRLRQYCLERPTDRDACKTQGELV
ADRDDLHAQADPRVGALMLMAPLSLMFGRHTLGDVHVPVLMYAGDDDQLL
ALDRNAEALARKLPQAPDYKLLAGAGHFVFMAPCSDEQREAAPLLCNDPD
GVDREDIHRNLSAEAVRFFSAALNSADADHSGMQTAHHQ


References
2 more
    Title: Genome sequence analyses of Pseudomonas savastanoi pv. glycinea and subtractive hybridization-based comparative genomics with nine pseudomonads
    Qi M, Wang D, Bradley CA, Zhao Y
    Ref: PLoS ONE, 6:e16451, 2011 : PubMed

            

    Title: A draft genome sequence of Pseudomonas syringae pv. tomato T1 reveals a type III effector repertoire significantly divergent from that of Pseudomonas syringae pv. tomato DC3000
    Almeida NF, Yan S, Lindeberg M, Studholme DJ, Schneider DJ, Condon B, Liu H, Viana CJ, Warren A and Vinatzer BA <8 more author(s)>
    Ref: Mol Plant Microbe Interact, 22:52, 2009 : PubMed

            

    Title: The complete genome sequence of the Arabidopsis and tomato pathogen Pseudomonas syringae pv. tomato DC3000
    Buell CR, Joardar V, Lindeberg M, Selengut J, Paulsen IT, Gwinn ML, Dodson RJ, DeBoy RT, Durkin AS and Collmer A <34 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:10181, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer