Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesy-SYPC

Pseudomonas syringae (pv. syringae) syringopeptin synthetase c

Comment
only the last thioesterase domain is introduced in the database but small repeat in the 12000 aa N-term show also homologies Q4ZT67 strain B728a Feil et al


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Pseudomonas syringae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas syringae group: N E > Pseudomonas syringae group genomosp. 1: N E > Pseudomonas syringae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF286216, CP000075
1 UniProt : Q4ZT67
2 UniProt : Q83VS0, Q4ZT67
2 Interpro : Q83VS0, Q4ZT67
2 Pfam : Q83VS0, Q4ZT67
2 PIRSF : Q83VS0, Q4ZT67
2 SUPERFAM : Q83VS0, Q4ZT67
Sequence
Graphical view for this peptide sequence: psesy-SYPC
Colored MSA for Thioesterase (raw)
APVFCVPGAGDSVTGFIGLAEALGPHWPIHGLQPRGLDGRTVPYSLVETA
AEAYLQALDSTHPEGPVHLLGHSFGGWVAFEMAQRLTARGREVASLTLID
SESPGGNGVVGKPYTAIGVLERLIETMELAAGKSLGIDRAAFRAQDDVGQ
MRLLHAGMVRAGMLPQRSSPDAMRGPARAFGTALRTRYQPSQIYTGPVRL
VLADDPVLDAAGNQREQQAMVSGWRQCAPDLTVWRGPGNHFTILKAQHVR
HLANWWLPHE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

APVFCVPGAGDSVTGFIGLAEALGPHWPIHGLQPRGLDGRTVPYSLVETA
AEAYLQALDSTHPEGPVHLLGHSFGGWVAFEMAQRLTARGREVASLTLID
SESPGGNGVVGKPYTAIGVLERLIETMELAAGKSLGIDRAAFRAQDDVGQ
MRLLHAGMVRAGMLPQRSSPDAMRGPARAFGTALRTRYQPSQIYTGPVRL
VLADDPVLDAAGNQREQQAMVSGWRQCAPDLTVWRGPGNHFTILKAQHVR
HLANWWLPHE


References
    Title: Comparison of the complete genome sequences of Pseudomonas syringae pv. syringae B728a and pv. tomato DC3000
    Feil H, Feil WS, Chain P, Larimer F, DiBartolo G, Copeland A, Lykidis A, Trong S, Nolan M and Lindow SE <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 102:11064, 2005 : PubMed

            

    Title: The complete genome sequence of the Arabidopsis and tomato pathogen Pseudomonas syringae pv. tomato DC3000
    Buell CR, Joardar V, Lindeberg M, Selengut J, Paulsen IT, Gwinn ML, Dodson RJ, DeBoy RT, Durkin AS and Collmer A <34 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:10181, 2003 : PubMed

            

    Title: The sypA, sypS, and sypC synthetase genes encode twenty-two modules involved in the nonribosomal peptide synthesis of syringopeptin by Pseudomonas syringae pv. syringae B301D
    Scholz-Schroeder BK, Soule JD, Gross DC
    Ref: Mol Plant Microbe Interact, 16:271, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer