Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseth-a0a1m6y2k1

Pseudonocardia thermophila Acetyl esterase/lipase, Hormone-sensitive_lipase_like family IV esterase

Comment
Other strains: Pseudonocardia thermophila; uncultured bacterium


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Pseudonocardia thermophila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Pseudonocardia: N E > Pseudonocardia thermophila: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 6Z68, 6Z69
No kinetic





No Substrate
2 inhibitors: 4-methylumbelliferyl-hexylphosphonate, N-Hexylphosphonate-Ethyl-Ester
3 Genbank : WP_073459097, SHL12339, MW408085
2 UniProt : A0A1M6Y2K1, A0A889H7P3
2 Structure : 6Z69, 6Z68
2 UniProt : A0A1M6Y2K1, A0A889H7P3
2 Interpro : A0A1M6Y2K1, A0A889H7P3
2 Pfam : A0A1M6Y2K1, A0A889H7P3
2 PIRSF : A0A1M6Y2K1, A0A889H7P3
2 SUPERFAM : A0A1M6Y2K1, A0A889H7P3
Sequence
Graphical view for this peptide sequence: pseth-a0a1m6y2k1
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTTTSNSTETGRRPGRLGDPDRCLRTDPRTDPRTVEALAPFGLDVNAAPA
PIGPDAPREQQLEYAMGAEAAFEGVFAALMDGLDPVPGIERRTETISGPA
GNEIKLYVHRPAGAVGPLPGIFHIHGGGMVILQAAGPVYVRFRDELAATG
TVVVGVEYRNGAGVLGPHPFPAGLHDCAVALDWVHARRAELGISTLTVAG
ESGGGNLTLATAIRAKREGRLDAIDGVYALVPYISGMYGRSREEREAELP
SLVECDGYFISCDLCAVFVELYDPGTAHLTDPLAWPYHAAREDLVGLPPH
VISVNEVDPLRDEGLAYYRKLVEAGVEARSRVVPGACHAADMMFRKAAPD
MYEATVQDIHDFVTSLHR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTTSNSTETGRRPGRLGDPDRCLRTDPRTDPRTVEALAPFGLDVNAAPA
PIGPDAPREQQLEYAMGAEAAFEGVFAALMDGLDPVPGIERRTETISGPA
GNEIKLYVHRPAGAVGPLPGIFHIHGGGMVILQAAGPVYVRFRDELAATG
TVVVGVEYRNGAGVLGPHPFPAGLHDCAVALDWVHARRAELGISTLTVAG
ESGGGNLTLATAIRAKREGRLDAIDGVYALVPYISGMYGRSREEREAELP
SLVECDGYFISCDLCAVFVELYDPGTAHLTDPLAWPYHAAREDLVGLPPH
VISVNEVDPLRDEGLAYYRKLVEAGVEARSRVVPGACHAADMMFRKAAPD
MYEATVQDIHDFVTSLHR


References
    Title: Metagenomic Screening for Lipolytic Genes Reveals an Ecology-Clustered Distribution Pattern
    Lu M, Schneider D, Daniel R
    Ref: Front Microbiol, 13:851969, 2022 : PubMed

            

    Title: Crystal structures of a novel family IV esterase in free and substrate-bound form
    Hoppner A, Bollinger A, Kobus S, Thies S, Coscolin C, Ferrer M, Jaeger KE, Smits SHJ
    Ref: Febs J, 288:3570, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer