Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseul-g2iue3

Pseudogulbenkiania sp.; Pseudogulbenkiania ferrooxidans, Putative uncharacterized protein

Comment
Other strains: Pseudogulbenkiania sp. (strain NH8B); Pseudogulbenkiania ferrooxidans 2002


Relationship
Family|abh_upf00227
Block| X
Position in NCBI Life Tree|Pseudogulbenkiania sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Neisseriales: N E > Chromobacteriaceae: N E > Pseudogulbenkiania: N E > Pseudogulbenkiania sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AP012224, ACIS01000007
2 UniProt : G2IUE3, B9Z5C2
2 UniProt : G2IUE3, B9Z5C2
2 Interpro : G2IUE3, B9Z5C2
2 Prodom : G2IUE3, B9Z5C2
2 Pfam : G2IUE3, B9Z5C2
2 PIRSF : G2IUE3, B9Z5C2
2 SUPERFAM : G2IUE3, B9Z5C2
Sequence
Graphical view for this peptide sequence: pseul-g2iue3
Colored MSA for abh_upf00227 (raw)
MPHIVYLHGFNSSEHSAKARETAAFLDQCGLAETFHCPRLPPHPADAIAA
ATALLQRLPADTLLIGSSLGGFYASWLAEALGLRAVLINPAVRPDRSLAA
YIGPQTNPYTGEQYTLGEADLTALRRLTVERPNAERYWLVLGTADEVLDW
REAARHYRGARQTVFFGDDHRLARWPECLPGVLAWAGDERRERVDET
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPHIVYLHGFNSSEHSAKARETAAFLDQCGLAETFHCPRLPPHPADAIAA
ATALLQRLPADTLLIGSSLGGFYASWLAEALGLRAVLINPAVRPDRSLAA
YIGPQTNPYTGEQYTLGEADLTALRRLTVERPNAERYWLVLGTADEVLDW
REAARHYRGARQTVFFGDDHRLARWPECLPGVLAWAGDERRERVDET


Reference
    Title: Complete genome sequence of the denitrifying and N(2)O-reducing bacterium Pseudogulbenkiania sp. strain NH8B
    Ishii S, Tago K, Nishizawa T, Oshima K, Hattori M, Senoo K
    Ref: Journal of Bacteriology, 193:6395, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer