Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseut-f8h720

Pseudomonas stutzeri Hydrolase or acyltransferase

Comment
Other strains: Pseudomonas stutzeri (strain ATCC 17588 / DSM 5190 / CCUG 11256 / JC 5965 / LMG 11199 / NCIMB 11358 / Stanier 221; DSM 4166 / CMT.9.A; A1501) Hydrolase or acyltransferase


Relationship
Family|DLH-S
Block| X
Position in NCBI Life Tree|Pseudomonas stutzeri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas stutzeri group: N E > Pseudomonas stutzeri subgroup: N E > Pseudomonas stutzeri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP002881, CP002622, CP000304
2 UniProt : F8H720, A4VGH8
2 UniProt : F8H720, A4VGH8
2 Interpro : F8H720, A4VGH8
2 Prodom : F8H720, A4VGH8
2 Pfam : F8H720, A4VGH8
2 PIRSF : F8H720, A4VGH8
2 SUPERFAM : F8H720, A4VGH8
Sequence
Graphical view for this peptide sequence: pseut-f8h720
Colored MSA for DLH-S (raw)
MSQSSATPMRFTLGKARLHGDLCVPAAARGLVVFVHGSGSSRHSPRNQSV
ARCFNEMGLATLLFDLLTKHEQPIDEITRQLRFDIPLLSQRLTGVIDQLS
SDAQLRELRIGLFGASTGAAAALTTAASRPADIAAVVSRGGRVDLAEPSL
ARVHAASLFIVGSRDLEVLELNRAAAARLQCEHQLVVVPGASHLFEEHGT
LEEVARLAGDWFVRHLV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSQSSATPMRFTLGKARLHGDLCVPAAARGLVVFVHGSGSSRHSPRNQSV
ARCFNEMGLATLLFDLLTKHEQPIDEITRQLRFDIPLLSQRLTGVIDQLS
SDAQLRELRIGLFGASTGAAAALTTAASRPADIAAVVSRGGRVDLAEPSL
ARVHAASLFIVGSRDLEVLELNRAAAARLQCEHQLVVVPGASHLFEEHGT
LEEVARLAGDWFVRHLV


Reference
    Title: Complete genome sequence of the nitrogen-fixing and rhizosphere-associated bacterium Pseudomonas stutzeri strain DSM4166
    Yu H, Yuan M, Lu W, Yang J, Dai S, Li Q, Yang Z, Dong J, Sun L and Lin M <8 more author(s)>
    Ref: Journal of Bacteriology, 193:3422, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer