Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psyck-q1qdq6

Psychrobacter cryohalolentis (strain K5) homoserine o-acetyltransferase (EC 2.3.1.31)

Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Psychrobacter cryohalolentis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Psychrobacter: N E > Psychrobacter cryohalolentis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AAJC01000001, CP000323
1 UniProt : Q1QDQ6
1 UniProt : Q1QDQ6
1 Interpro : Q1QDQ6
1 Prodom : Q1QDQ6
1 Pfam : Q1QDQ6
1 PIRSF : Q1QDQ6
1 SUPERFAM : Q1QDQ6
Sequence
Graphical view for this peptide sequence: psyck-q1qdq6
Colored MSA for Homoserine_transacetylase (raw)
MNARPDNTSDQSATDKSNAKGNAKSSINTEELLNSVGVVTPQTLHFAEPL
TLECNRTLPSFDLIIETYGTLNSDKSNAVLICHALSGSHHAAGFHSDEDQ
KAGWWDNMIGPNKSIDTNRFFVVCVNNIGSCFGSTGPTTINPDSSQAQVY
GPDFPLVTIKDWVKTQAMLSDRLGIDVWHAVVGGSMGGMQALQWSVDYPN
RLKRCVVIASTPKLSAQNIAFNEVARQSILSDPDFKDGRYLLAGTYPRRG
LILARMVGHITYLTDDAMKAKFGRDLKSGKFMYGYDVEFQVESYLRYQGE
RFSENFDANTYLLMTKALDYFDPTRDYPLESAIDSSPESLASSLAESVKA
DSSENELANTLADSADIDNISATNHQELTALKAAFAHTECQYLIVSFTTD
WRFAPERSQEIVDALMATGKPVSYINVDAPHGHDSFLFDIPRYMGAVKGF
LNAPFMTDNRDQNSQKTLGARS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNARPDNTSDQSATDKSNAKGNAKSSINTEELLNSVGVVTPQTLHFAEPL
TLECNRTLPSFDLIIETYGTLNSDKSNAVLICHALSGSHHAAGFHSDEDQ
KAGWWDNMIGPNKSIDTNRFFVVCVNNIGSCFGSTGPTTINPDSSQAQVY
GPDFPLVTIKDWVKTQAMLSDRLGIDVWHAVVGGSMGGMQALQWSVDYPN
RLKRCVVIASTPKLSAQNIAFNEVARQSILSDPDFKDGRYLLAGTYPRRG
LILARMVGHITYLTDDAMKAKFGRDLKSGKFMYGYDVEFQVESYLRYQGE
RFSENFDANTYLLMTKALDYFDPTRDYPLESAIDSSPESLASSLAESVKA
DSSENELANTLADSADIDNISATNHQELTALKAAFAHTECQYLIVSFTTD
WRFAPERSQEIVDALMATGKPVSYINVDAPHGHDSFLFDIPRYMGAVKGF
LNAPFMTDNRDQNSQKTLGARS



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer