Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psyck-q1qeu6

Psychrobacter cryohalolentis (strain K5) alpha/beta hydrolase fold precursor

Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|Psychrobacter cryohalolentis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Psychrobacter: N E > Psychrobacter cryohalolentis: N E


Molecular evidence
Database
No mutation
1 structure:
4NS4: Crystal structure of cold-active esterase from Psychrobacter cryohalolentis K5
No kinetic





No Substrate
No inhibitor
2 Genbank : AAJC01000046, CP000323
1 UniProt : Q1QEU6
1 Structure : 4NS4
1 UniProt : Q1QEU6
1 Interpro : Q1QEU6
1 Prodom : Q1QEU6
1 Pfam : Q1QEU6
1 PIRSF : Q1QEU6
1 SUPERFAM : Q1QEU6
Sequence
Graphical view for this peptide sequence: psyck-q1qeu6
Colored MSA for ABHD6-Lip (raw)
MLLKRLGLATLLSFSVVGCTTAPNTLAINTTQKIIQYERSKSDLTTQSFT
LSSGDKIVYAENGNVAGEPLLLVHGFGGNKDNFTRIARQLENYNLIIPDL
LGFGDSSKPMAADYHSEAQATRLHELLQAKGLASSIHVGGNSMGGAISVA
YAAKYPKEVKSLWLIDSAGFWSAGVPKSLESATLENNPLLVDKKEDFYAM
YDFVMSKPPYIPKSVKAVFAQERIANKALESKILAQIVEDNVEQRAKVIT
EYNIPTLVVWGEEDKVIKPETVTLIKEIIPQSQVITMPKIGHVPMIEAVK
DTANDYKAFREGLKN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLKRLGLATLLSFSVVGCTTAPNTLAINTTQKIIQYERSKSDLTTQSFT
LSSGDKIVYAENGNVAGEPLLLVHGFGGNKDNFTRIARQLENYNLIIPDL
LGFGDSSKPMAADYHSEAQATRLHELLQAKGLASSIHVGGNSMGGAISVA
YAAKYPKEVKSLWLIDSAGFWSAGVPKSLESATLENNPLLVDKKEDFYAM
YDFVMSKPPYIPKSVKAVFAQERIANKALESKILAQIVEDNVEQRAKVIT
EYNIPTLVVWGEEDKVIKPETVTLIKEIIPQSQVITMPKIGHVPMIEAVK
DTANDYKAFREGLKN


Reference
    Title: Expression and chaperone-assisted refolding of a new cold-active lipase from Psychrobacter cryohalolentis K5(T)
    Novototskaya-Vlasova K, Petrovskaya LE, Kryukova E, Rivkina E, Dolgikh D, Kirpichnikov M
    Ref: Protein Expr Purif, 91:96, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer