Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pucgt-e3kgl6

Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL)(Black stem rust fungus) Putative uncharacterized protein

Relationship
Family|Carb_B_Root
Block| C
Position in NCBI Life Tree|Puccinia graminis f. sp. tritici
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Pucciniomycotina: N E > Pucciniomycetes: N E > Pucciniales: N E > Pucciniaceae: N E > Puccinia: N E > Puccinia graminis: N E > Puccinia graminis f. sp. tritici: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DS178286
1 UniProt : E3KGL6
1 UniProt : E3KGL6
1 Interpro : E3KGL6
1 Pfam : E3KGL6
1 PIRSF : E3KGL6
1 SUPERFAM : E3KGL6
Sequence
Graphical view for this peptide sequence: pucgt-e3kgl6
Colored MSA for Carb_B_Root (raw)
MYWGGIGVWQNSQVFLRPVILVVPLINLQRSLLRNSVALYVLTLLTPIPA
LVPADFLDSEELQMAAIKTLYGPVAGFDDPFPTVQSDSCPHEQSDGGEAP
VSKWLGIPYARAGRWQRPRSPTPWAAPLQCTKFGPRFPQALNLTDLIFSR
KEGFNQNQHSPPESEELGFNLNVFAPKSSQVTGELPVLVWIYGGSLEGGS
SDSAIYDPTEWIRRESHEGRNFIVVTGNYRCGIFGFMACQDLVEDDSEDL
AGNYGQAQLLQLYGKDRSDIELLLKELMIALQCFNGWVSFVQDNIRAFGG
NPDNVTIFGESAGAFLVGALLVTQQKLFKQAILQSGAPETLTHRSVDSSI
NREYFESLLQHFNIPHGLASEQRIKLLKEIPTSKIMEFVSARGAVVNDYG
LTIEESVKSSIWTKPAIELIKERKWNPHLKSLLMGHTKDEGSIFAFFFQT
TTKEGYEHVLRKRCPFSPQNKIEKLYPPPEDLETQTPLTTDWKNCAGSRL
IADQLCESPMENLAMSFDEIGEHCKAFCIQAIRPMSTSS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYWGGIGVWQNSQVFLRPVILVVPLINLQRSLLRNSVALYVLTLLTPIPA
LVPADFLDSEELQMAAIKTLYGPVAGFDDPFPTVQSDSCPHEQSDGGEAP
VSKWLGIPYARAGRWQRPRSPTPWAAPLQCTKFGPRFPQALNLTDLIFSR
KEGFNQNQHSPPESEELGFNLNVFAPKSSQVTGELPVLVWIYGGSLEGGS
SDSAIYDPTEWIRRESHEGRNFIVVTGNYRCGIFGFMACQDLVEDDSEDL
AGNYGQAQLLQLYGKDRSDIELLLKELMIALQCFNGWVSFVQDNIRAFGG
NPDNVTIFGESAGAFLVGALLVTQQKLFKQAILQSGAPETLTHRSVDSSI
NREYFESLLQHFNIPHGLASEQRIKLLKEIPTSKIMEFVSARGAVVNDYG
LTIEESVKSSIWTKPAIELIKERKWNPHLKSLLMGHTKDEGSIFAFFFQT
TTKEGYEHVLRKRCPFSPQNKIEKLYPPPEDLETQTPLTTDWKNCAGSRL
IADQLCESPMENLAMSFDEIGEHCKAFCIQAIRPMSTSS



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer