Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pyrbr-Q9Y7G8

Pyrenopeziza brassicae cutinase (EC 3.1.1.74) (cutin hydrolase) PbCut Pbc1

Comment
Best pNP substrate pNP-C2 Paranitrophenylacetate, pNP-C4 Paranitrophenylbutyrate


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Pyrenopeziza brassicae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Leotiomycetes: N E > Helotiales: N E > Dermateaceae: N E > Pyrenopeziza: N E > Pyrenopeziza brassicae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





3 substrates: Paranitrophenyl-palmitate, Paranitrophenylacetate, Paranitrophenylbutyrate
No inhibitor
1 Genbank : AJ009953
1 UniProt : Q9Y7G8
1 UniProt : Q9Y7G8
1 Interpro : Q9Y7G8
1 Prodom : Q9Y7G8
1 Pfam : Q9Y7G8
1 PIRSF : Q9Y7G8
1 SUPERFAM : Q9Y7G8
Sequence
Graphical view for this peptide sequence: pyrbr-Q9Y7G8
Colored MSA for Cutinase (raw)
MKVTALGNTLTGFGQALATTLGVDTTSSSPNCAEMMVVFARGTSEPGNVG
LFSGPTFFDALEVMMGAGAVSVQGVEYGASIEGFLQGGDPAGSAAMAGIV
EGTVQNCPNAKIVMSGYSQGGQLVHNAAAMLPAATMAKISSLVIFGDPND
GKPIANADPSKVMVVCHPGHNICDGRDLVLVEHLTYSRDAVEAATFAAAR
AKA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVTALGNTLTGFGQALATTLGVDTTSSSPNCAEMMVVFARGTSEPGNVG
LFSGPTFFDALEVMMGAGAVSVQGVEYGASIEGFLQGGDPAGSAAMAGIV
EGTVQNCPNAKIVMSGYSQGGQLVHNAAAMLPAATMAKISSLVIFGDPND
GKPIANADPSKVMVVCHPGHNICDGRDLVLVEHLTYSRDAVEAATFAAAR
AKA


References
    Title: Phylogenetic analysis and in-depth characterization of functionally and structurally diverse CE5 cutinases
    Novy V, Carneiro LV, Shin JH, Larsbrink J, Olsson L
    Ref: Journal of Biological Chemistry, :101302, 2021 : PubMed

            

    Title: Molecular evidence that the extracellular cutinase Pbc1 is required for pathogenicity of Pyrenopeziza brassicae on oilseed rape
    Li D, Ashby AM, Johnstone K
    Ref: Mol Plant Microbe Interact, 16:545, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer