Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pyrfu-PF2001

Pyrococcus furiosus hypothetical protein pf2001

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Pyrococcus furiosus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Thermococci: N E > Thermococcales: N E > Thermococcaceae: N E > Pyrococcus: N E > Pyrococcus furiosus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
4 structures (e.g. : 5G59, 5G5C, 5G5M... more)
No kinetic





No Substrate
No inhibitor
1 Genbank : AE010293
>3 Structure links 1 more: 5LCN, 5G5M, 5G59
1 UniProt : Q8TZJ1
1 Interpro : Q8TZJ1
1 Pfam : Q8TZJ1
1 PIRSF : Q8TZJ1
1 SUPERFAM : Q8TZJ1
Sequence
Graphical view for this peptide sequence: pyrfu-PF2001
Colored MSA for AlphaBeta_hydrolase (raw)
MIIEILVAALVLFLVFTAFVGYKMVNPPRVVGNWTPKDLSFEYKDVEITT
EDNVKLSGWWIDNGSDKTVIPLHGYTSSRWAEHYMRPVIEFLLKEGYNVL
AFDFRAHGKSGGKYTTVGDKEILDLKAGVKWLKDNYPEKSKRIGVIGFSM
GALVAIRGLSEVKEICCGVADSPPIYLDKTGARGMKYFAKLPEWLYSFVK
PFSELFSGGRPINVLNYTNSIKKPLFLIIGRRDTLVKVEEVQEFYERNKH
VNPNVELWVTDAPHVRTIQVFPEEWKSRVGEFLKRWMG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIIEILVAALVLFLVFTAFVGYKMVNPPRVVGNWTPKDLSFEYKDVEITT
EDNVKLSGWWIDNGSDKTVIPLHGYTSSRWAEHYMRPVIEFLLKEGYNVL
AFDFRAHGKSGGKYTTVGDKEILDLKAGVKWLKDNYPEKSKRIGVIGFSM
GALVAIRGLSEVKEICCGVADSPPIYLDKTGARGMKYFAKLPEWLYSFVK
PFSELFSGGRPINVLNYTNSIKKPLFLIIGRRDTLVKVEEVQEFYERNKH
VNPNVELWVTDAPHVRTIQVFPEEWKSRVGEFLKRWMG


Reference
    Title: Structural Mechanism for the Temperature-Dependent Activation of the Hyperthermophilic Pf2001 Esterase
    Varejao N, De-Andrade RA, Almeida RV, Anobom CD, Foguel D, Reverter D
    Ref: Structure, 26:199, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer