Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pyrho-PH0594

Pyrococcus horikoshii hypothetical protein ph0594

Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Pyrococcus horikoshii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Thermococci: N E > Thermococcales: N E > Thermococcaceae: N E > Pyrococcus: N E > Pyrococcus horikoshii: N E


Molecular evidence
Database
No mutation
3 structures: 4HXE, 4HXF, 4HXG
No kinetic





No Substrate
1 inhbitor:
Z-Gly-Gly-Phe-chloromethyl-ketone
1 Genbank : AP000002
3 Structure : 4HXG, 4HXF, 4HXE
1 UniProt : O58323
1 Interpro : O58323
1 Prodom : O58323
1 Pfam : O58323
1 PIRSF : O58323
1 SUPERFAM : O58323
Sequence
Graphical view for this peptide sequence: pyrho-PH0594
Colored MSA for ACPH_Peptidase_S9 (raw)
MTSIEWDEKTFTKFAYLSDPRTRKNLVAYVLTKANLESNKYENTIVIENL
EDGSRKFIEDASMPRISPDGKKIAFMRFNEEKKTAQIWVADLKTLSAKKV
LEAKNIRSIEWNQDSRRLLAVGFKRREDEDFIFEDDVPAWFDNMGFFDGE
KTTFWVIDTEGEEVIEQFEKPRFSSGIWHGDSIVVSVPHRDVIPRYFKYW
DIYLWKDGEEEKLFEKVSFYAIDSDGERILLYGKPEKKYVSEHDKIYIYD
GEVKGILDDIDREVAQAKIRNGKVYFTLFEEGSVNLYLWDGEVREIAKGK
HWIMGFDADERLIYLKETATRPAELYLWDGEERQLTDYNGLIFKKLKTFE
PRHFRFKSIDLELDGWYIKPEIKEGEKAPVIVFVHGGPKGMYGYYFKYEM
QLMASKGYYIVYVNPRGSNGYSEDFALRVLERTGLEDFQDILNGIEEFLR
LEPQADRERIGITGISYGGYMTNWALTQSDLFKAGISENGISYWLTSYAF
SDIGLWFDKEVIGDNPLENENYRKLSPLFYAKNVKAPLLLIHSLEDYRCP
LDQSLMFYHVLKDLGKEVYIAIFKKGAHGHSIRGSPRHRMKRYKLFMEFF
ERKLKKYEEGFDVEKILKEEKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSIEWDEKTFTKFAYLSDPRTRKNLVAYVLTKANLESNKYENTIVIENL
EDGSRKFIEDASMPRISPDGKKIAFMRFNEEKKTAQIWVADLKTLSAKKV
LEAKNIRSIEWNQDSRRLLAVGFKRREDEDFIFEDDVPAWFDNMGFFDGE
KTTFWVIDTEGEEVIEQFEKPRFSSGIWHGDSIVVSVPHRDVIPRYFKYW
DIYLWKDGEEEKLFEKVSFYAIDSDGERILLYGKPEKKYVSEHDKIYIYD
GEVKGILDDIDREVAQAKIRNGKVYFTLFEEGSVNLYLWDGEVREIAKGK
HWIMGFDADERLIYLKETATRPAELYLWDGEERQLTDYNGLIFKKLKTFE
PRHFRFKSIDLELDGWYIKPEIKEGEKAPVIVFVHGGPKGMYGYYFKYEM
QLMASKGYYIVYVNPRGSNGYSEDFALRVLERTGLEDFQDILNGIEEFLR
LEPQADRERIGITGISYGGYMTNWALTQSDLFKAGISENGISYWLTSYAF
SDIGLWFDKEVIGDNPLENENYRKLSPLFYAKNVKAPLLLIHSLEDYRCP
LDQSLMFYHVLKDLGKEVYIAIFKKGAHGHSIRGSPRHRMKRYKLFMEFF
ERKLKKYEEGFDVEKILKEEKK


References
    Title: A self-compartmentalizing hexamer serine protease from Pyrococcus horikoshii: substrate selection achieved through multimerization
    Menyhard DK, Kiss-Szeman A, Tichy-Racs E, Hornung B, Radi K, Szeltner Z, Domokos K, Szamosi I, Naray-Szabo G and Harmat V <1 more author(s)>
    Ref: Journal of Biological Chemistry, 288:17884, 2013 : PubMed

            

    Title: Characterization of a novel acylaminoacyl peptidase with hexameric structure and endopeptidase activity
    Szeltner Z, Kiss AL, Domokos K, Harmat V, Naray-Szabo G, Polgar L
    Ref: Biochimica & Biophysica Acta, 1794:1204, 2009 : PubMed

            

    Title: Complete sequence and gene organization of the genome of a hyper-thermophilic archaebacterium, Pyrococcus horikoshii OT3
    Kawarabayasi Y, Sawada M, Horikawa H, Haikawa Y, Hino Y, Yamamoto S, Sekine M, Baba S, Kosugi H and Kikuchi H <15 more author(s)>
    Ref: DNA Research, 5:55, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer