Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rabit-ACHE

Oryctolagus cuniculus mRNA for acetylcholinesterase

Comment
Cterminus T peptide


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Oryctolagus cuniculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Lagomorpha: N E > Leporidae: N E > Oryctolagus: N E > Oryctolagus cuniculus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : U05036
1 UniProt : Q29499
1 Ncbi-nid : 576446
1 UniProt : Q29499
1 Interpro : Q29499
1 Prodom : Q29499
1 Pfam : Q29499
1 PIRSF : Q29499
1 SUPERFAM : Q29499
Sequence
Graphical view for this peptide sequence: rabit-ACHE
Colored MSA for ACHE (raw)
AEGREDPELLVTVRGGRLRGLRLKAPGGPVSAFLGIPFEEPPVGPRRFLP
PEPKRPWAGVLDATAFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYL
NVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYYGRFLVQAEGTVLVAM
NYRVGAFGFTCLPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPASVTL
FGESAGAASVGLHLLSPPSRGLFHRAVLQSGAPNGPWATVGVGEARRRAT
LLARLVVCPPGGAGGNDTELVACLRTRPAQDLVDHEWRVLPQESIFRFSF
VPVVDGDFLSDTPEALINAGDFQGLQVLVGVVKDEGTYFLVYGAPGFSKD
NESFISRAQFLAGVRVGVPQASDLAAEAVVLHYTDWLHPEDPARLRDALS
DVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGLPLEPSLNYTEEERIFAQRLMRYWANFARTGDPNEPRDAKAPQ
WPPYTAGAQQYVSLNLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEA
ERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

AEGREDPELLVTVRGGRLRGLRLKAPGGPVSAFLGIPFEEPPVGPRRFLP
PEPKRPWAGVLDATAFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYL
NVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYYGRFLVQAEGTVLVAM
NYRVGAFGFTCLPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPASVTL
FGESAGAASVGLHLLSPPSRGLFHRAVLQSGAPNGPWATVGVGEARRRAT
LLARLVVCPPGGAGGNDTELVACLRTRPAQDLVDHEWRVLPQESIFRFSF
VPVVDGDFLSDTPEALINAGDFQGLQVLVGVVKDEGTYFLVYGAPGFSKD
NESFISRAQFLAGVRVGVPQASDLAAEAVVLHYTDWLHPEDPARLRDALS
DVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGLPLEPSLNYTEEERIFAQRLMRYWANFARTGDPNEPRDAKAPQ
WPPYTAGAQQYVSLNLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEA
ERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL


Reference
    Title: Acetylcholinesterase and butyrylcholinesterase expression in adult rabbit tissues and during development
    Jbilo O, L'Hermite Y, Talesa V, Toutant JP, Chatonnet A
    Ref: European Journal of Biochemistry, 225:115, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer