Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rabit-O77820

Oryctolagus cuniculus (Rabbit) calcium-independent phospholipase a2 isoform 1 (fragment)

Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Oryctolagus cuniculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Lagomorpha: N E > Leporidae: N E > Oryctolagus: N E > Oryctolagus cuniculus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : U97147
1 UniProt : O77820
1 Interpro : O77820
1 Prodom : O77820
1 Pfam : O77820
1 PIRSF : O77820
1 SUPERFAM : O77820
Sequence
Graphical view for this peptide sequence: rabit-O77820
Colored MSA for LYsophospholipase_carboxylesterase (raw)
ASVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVMPV
TLNMNMAMPSWFDIIGLSPDSQEDEPGIKQAAENVKALIDQEVKNGIPSN
RIILGGFSQGGALSLYTALTTQQKLAEVTALSCWLPLRASFPQGPISGAN
RDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSC
QQEMMDVKQFIDKLLPPID
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ASVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVMPV
TLNMNMAMPSWFDIIGLSPDSQEDEPGIKQAAENVKALIDQEVKNGIPSN
RIILGGFSQGGALSLYTALTTQQKLAEVTALSCWLPLRASFPQGPISGAN
RDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSC
QQEMMDVKQFIDKLLPPID


Reference
    Title: cDNA cloning and expression of a novel family of enzymes with calcium-independent phospholipase A2 and lysophospholipase activities
    Portilla D, Crew MD, Grant D, Serrero G, Bates LM, Dai G, Sasner M, Cheng J, Buonanno A
    Ref: J Am Soc Nephrol, 9:1178, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer