Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rabit-hyep

Oryctolagus cuniculus (Rabbit) (epoxide hydratase)

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Oryctolagus cuniculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Lagomorpha: N E > Leporidae: N E > Oryctolagus: N E > Oryctolagus cuniculus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : M21496
1 UniProt : P04068
1 UniProt : P04068
1 Interpro : P04068
1 Prodom : P04068
1 Pfam : P04068
1 PIRSF : P04068
1 SUPERFAM : P04068
Sequence
Graphical view for this peptide sequence: rabit-hyep
Colored MSA for Epoxide_hydrolase (raw)
MLLELLLASVLGFVIYWFVSGDKEESLPLEDGWWGPGSRPVGLEDESIRP
FKVETSDEEINDLHQRIDRIRLTPPLENSRFHYGFNSNYLKKILSYWRHE
FDWKKQVEILNSYPHFKTKIEGLDIHFIHVKPPQVPPGRTPKPLLMVHGW
PGSFFEFYKIIPLLTDPKSHGLSDEHIFEVICPSIPGYGFSQASSKKGFN
SVSTARIFYKLMLRLGFQEFYIQGGDWGALVCTNMAQLVPSHVKGLHLNM
ALILRNHYTLTLLLGRRIGGLLGYTERDMELLYPFKEKVFYSLMRESGYM
HIRATKPDTVGCALNDSPVGLAAYILEKFSTWTNSEFRDLEDGGLERKFS
LQDLLTNIMIYWTTGSIVSSQRYYKENLGQGFMAHKHERLKVHVPTGFAA
FPCEIMHVPEKWVRTKYPQLISYSYMPRGGHFAAFEEPELLARDICKFVG
LVERQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLELLLASVLGFVIYWFVSGDKEESLPLEDGWWGPGSRPVGLEDESIRP
FKVETSDEEINDLHQRIDRIRLTPPLENSRFHYGFNSNYLKKILSYWRHE
FDWKKQVEILNSYPHFKTKIEGLDIHFIHVKPPQVPPGRTPKPLLMVHGW
PGSFFEFYKIIPLLTDPKSHGLSDEHIFEVICPSIPGYGFSQASSKKGFN
SVSTARIFYKLMLRLGFQEFYIQGGDWGALVCTNMAQLVPSHVKGLHLNM
ALILRNHYTLTLLLGRRIGGLLGYTERDMELLYPFKEKVFYSLMRESGYM
HIRATKPDTVGCALNDSPVGLAAYILEKFSTWTNSEFRDLEDGGLERKFS
LQDLLTNIMIYWTTGSIVSSQRYYKENLGQGFMAHKHERLKVHVPTGFAA
FPCEIMHVPEKWVRTKYPQLISYSYMPRGGHFAAFEEPELLARDICKFVG
LVERQ


References
    Title: Rabbit microsomal epoxide hydrolase: isolation and characterization of the xenobiotic metabolizing enzyme cDNA
    Hassett C, Turnblom SM, DeAngeles A, Omiecinski CJ
    Ref: Archives of Biochemistry & Biophysics, 271:380, 1989 : PubMed

            

    Title: The covalent structure of hepatic microsomal epoxide hydrolase. II. The complete amino acid sequence
    Heinemann FS, Ozols J
    Ref: Journal of Biological Chemistry, 259:797, 1984 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer